Cart (0 Items)
Your cart is currently empty.
View Products
              
              
              | size | 100ug  | 
		
|---|---|
| Isotype | IgG  | 
		
| Brand | ProteoGenix  | 
		
| Product type | COVID-19 products  | 
		
| Host Species | Rabbit  | 
		
| Clonality | Polyclonal Antibody  | 
		
| Applications | Elisa  | 
		
| Product name | Anti-ORF7a protein polyclonal antibody | 
|---|---|
| Source | P0DTC7 | 
| Species | SARS-CoV-2 | 
| Molecular weight | 13kDa | 
| Buffer | PBS, pH7.4, containing 0.05% proclin300, 50% glycerol | 
| Form | Liquid | 
| Delivery condition | Blue ice (+4°C) | 
| Storage condition | 4°C for short term; -20°c or -80°C for long term | 
| Brand | Proteogenix | 
| Host species | Rabbit | 
| Aliases – Synonyms | ORF7a protein | 
| Size | 100ug | 
| Reference | PTXCOV-A559 | 
| Note | For research use and in vitro diagnostic only. Not suitable for human use. | 
| Isotype | IgG | 
| Clonality | Polyclonal Antibody | 
| Target | ORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE | 
Send us a message from the form below
Reviews
There are no reviews yet.