Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Isotype | IgG |
| Brand | ProteoGenix |
| Product type | COVID-19 products |
| Host Species | Rabbit |
| Clonality | Polyclonal Antibody |
| Applications | Elisa |
| Product name | Anti-ORF7a protein polyclonal antibody |
|---|---|
| Source | P0DTC7 |
| Species | SARS-CoV-2 |
| Molecular weight | 13kDa |
| Buffer | PBS, pH7.4, containing 0.05% proclin300, 50% glycerol |
| Form | Liquid |
| Delivery condition | Blue ice (+4°C) |
| Storage condition | 4°C for short term; -20°c or -80°C for long term |
| Brand | Proteogenix |
| Host species | Rabbit |
| Aliases – Synonyms | ORF7a protein |
| Size | 100ug |
| Reference | PTXCOV-A559 |
| Note | For research use and in vitro diagnostic only. Not suitable for human use. |
| Isotype | IgG |
| Clonality | Polyclonal Antibody |
| Target | ORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE |
Send us a message from the form below
Reviews
There are no reviews yet.