Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Chromosomal replication initiator protein DnaA |
---|---|
Uniprot ID | D7HH42 |
Uniprot link | http://www.uniprot.org/uniprot/D7HH42 |
Expression system | Prokaryotic expression |
Sequence | MGLSEGIVSSSLWLQCLQRLQEELPAAEFSMWVRPLQAELNDNTLTLFAPNRFVLDWVRDKYLNNINRLLMEFSGNDVPN LRFEVGSRPVVAPKPAPVRTAADVAAESSAPAQLAQRKPIHKTWDDDSAAADITHRSNVNPKHKFNNFVEGKSNQLGLAA ARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALL IDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDH QIHLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVAD LLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLIRTLSSGSHHHH HH |
Molecular weight | 54.43kDa |
Purity estimated | >40% by SDS-PAGE |
Buffer | 50 mM Tris-HCl pH 8.0, 150 mM NaCl/PBS pH 7.5, 4 M urea |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Mer1-472Ser |
Aliases /Synonyms | / |
Reference | PX-P4506 |
Note | For research use only |
This entry represents the central domain of bacterial DnaA protein, which plays an important role in initiating and regulating chromosome replication. DnaA is an ATP and DNA binding protein. It specifically binds to a 9 bp nucleotide repeat sequence, the dnaA box, which is found in the chromosomal origin of replication (oriC). DnaA is a protein of about 50kDa and contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP binding domain, and the second is located in the C-terminal half and may be involved in DNA binding. The protein can also bind RNA polymerase β subunit, dnaB and dnaZ proteins, and groE gene products (chaperone proteins).
Send us a message from the form below
Reviews
There are no reviews yet.