Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now

Human FGF2b Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameHuman FGF2b Recombinant Protein
Uniprot IDP09038
Uniprot linkhttp://www.uniprot.org/uniprot/P09038
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVC ANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight17,76 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAA52534.1
Spec:Entrez GeneID2247
Spec:NCBI Gene AliasesFGFB, HBGF-2, FGF-2, BFGF
Spec:SwissProtIDP09038
NCBI ReferenceAAA52534.1
Aliases /SynonymsFGF2b, basic fibroblast Growth Factor proteins, FGF2, Fibroblast Growth Factor proteins 2, FGF-2, bFGF, Heparin-binding Growth Factor proteins 2, HBGF-2
ReferencePX-P1089
NoteFor research use only

Publication

  • 1: Wróbel T, Butrym A, Łacina P, Rybka J, Gębura K, Mazur G, Bogunia-Kubik K._x000D_ bFGF Polymorphism Is Associated with Disease Progression and Response to_x000D_ Chemotherapy in Multiple Myeloma Patients. Anticancer Res. 2017_x000D_ Apr;37(4):1799-1803. PubMed PMID: 28373444.
  • _x000D_ _x000D_ _x000D_
  • 2: Neutralizing Monoclonal Antibody 3B1 Against Human Basic Fibroblast Growth_x000D_ Factor. Monoclon Antib Immunodiagn Immunother. 2016 Apr;35(2):122. doi:_x000D_ 10.1089/mab.2015.0080. PubMed PMID: 27097071.
  • _x000D_ _x000D_ _x000D_
  • 3: Hao RH, Guo Y, Dong SS, Weng GZ, Yan H, Zhu DL, Chen XF, Chen JB, Yang TL._x000D_ Associations of Plasma FGF2 Levels and Polymorphisms in the FGF2 Gene with_x000D_ Obesity Phenotypes in Han Chinese Population. Sci Rep. 2016 Feb 16;6:19868. doi: _x000D_ 10.1038/srep19868. PubMed PMID: 26879180; PubMed Central PMCID: PMC4754629.
  • _x000D_ _x000D_ _x000D_
  • 4: Shi H, Xu J, Zhao R, Wu H, Gu L, Chen Y. FGF2 regulates proliferation,_x000D_ migration, and invasion of ECA109 cells through PI3K/Akt signalling pathway in_x000D_ vitro. Cell Biol Int. 2016 May;40(5):524-33. doi: 10.1002/cbin.10588. Epub 2016_x000D_ Mar 9. PubMed PMID: 26833879.
  • _x000D_ _x000D_ _x000D_
  • 5: Hu M, Hu Y, He J, Li B. Prognostic Value of Basic Fibroblast Growth Factor proteins_x000D_ (bFGF) in Lung Cancer: A Systematic Review with Meta-Analysis. PLoS One. 2016 Jan_x000D_ 29;11(1):e0147374. doi: 10.1371/journal.pone.0147374. eCollection 2016. Review._x000D_ PubMed PMID: 26824699; PubMed Central PMCID: PMC4732945.
  • _x000D_ _x000D_ _x000D_
  • 6: Ye L, Yang Y, Zhang X, Cai P, Li R, Chen D, Wei X, Zhang X, Xu H, Xiao J, Li_x000D_ X, Lin L, Zhang H. The Role of bFGF in the Excessive Activation of Astrocytes Is _x000D_ Related to the Inhibition of TLR4/NFκB Signals. Int J Mol Sci. 2015 Dec 28;17(1)._x000D_ pii: E37. doi: 10.3390/ijms17010037. PubMed PMID: 26729092; PubMed Central PMCID:_x000D_ PMC4730282.
  • _x000D_ _x000D_ _x000D_
  • 7: Twaroski K, Mallanna SK, Jing R, DiFurio F, Urick A, Duncan SA. FGF2 mediates _x000D_ hepatic progenitor cell formation during human pluripotent stem cell_x000D_ differentiation by inducing the WNT antagonist NKD1. Genes Dev. 2015 Dec_x000D_ 1;29(23):2463-74. doi: 10.1101/gad.268961.115. PubMed PMID: 26637527; PubMed_x000D_ Central PMCID: PMC4691950.
  • _x000D_ _x000D_ _x000D_
  • 8: Lim S, Cho H, Lee E, Won Y, Kim C, Ahn W, Lee E, Son Y. Osteogenic stimulation_x000D_ of human adipose-derived stem cells by pre-treatment with fibroblast growth_x000D_ factor 2. Cell Tissue Res. 2016 Apr;364(1):137-47. doi:_x000D_ 10.1007/s00441-015-2311-8. Epub 2015 Nov 7. PubMed PMID: 26547859.
  • _x000D_ _x000D_ _x000D_
  • 9: Chen Y, Zhu G, Wu K, Gao Y, Zeng J, Shi Q, Guo P, Wang X, Chang LS, Li L, He_x000D_ D. FGF2-mediated reciprocal tumor cell-endothelial cell interplay contributes to _x000D_ the growth of chemoresistant cells: a potential mechanism for superficial bladder_x000D_ cancer recurrence. Tumour Biol. 2016 Apr;37(4):4313-21. doi:_x000D_ 10.1007/s13277-015-4214-4. Epub 2015 Oct 22. PubMed PMID: 26493998.
  • _x000D_ _x000D_ _x000D_
  • 10: Zhao W, Yu H, Han Z, Gao N, Xue J, Wang Y. Clinical significance of joint_x000D_ detection of serum CEA, SCCA, and bFGF in the diagnosis of lung cancer. Int J_x000D_ Clin Exp Pathol. 2015 Aug 1;8(8):9506-11. eCollection 2015. PubMed PMID:_x000D_ 26464712; PubMed Central PMCID: PMC4583944.
  • _x000D_ _x000D_ _x000D_
  • 11: Litwin M, Radwańska A, Paprocka M, Kieda C, Dobosz T, Witkiewicz W, Baczyńska_x000D_ D. The role of FGF2 in migration and tubulogenesis of endothelial progenitor_x000D_ cells in relation to pro-angiogenic Growth Factor proteins production. Mol Cell Biochem._x000D_ 2015 Dec;410(1-2):131-42. doi: 10.1007/s11010-015-2545-5. Epub 2015 Aug 28._x000D_ PubMed PMID: 26314253.
  • _x000D_ _x000D_ _x000D_
  • 12: Fessler E, Borovski T, Medema JP. Endothelial cells induce cancer stem cell_x000D_ features in differentiated glioblastoma cells via bFGF. Mol Cancer. 2015 Aug_x000D_ 19;14:157. doi: 10.1186/s12943-015-0420-3. PubMed PMID: 26282129; PubMed Central _x000D_ PMCID: PMC4539660.
  • _x000D_ _x000D_ _x000D_
  • 13: Jerebtsova M, Das JR, Tang P, Wong E, Ray PE. Angiopoietin-1 prevents severe _x000D_ bleeding complications induced by heparin-like drugs and fibroblast growth_x000D_ factor-2 in mice. Am J Physiol Heart Circ Physiol. 2015 Oct;309(8):H1314-25. doi:_x000D_ 10.1152/ajpheart.00373.2015. Epub 2015 Aug 14. PubMed PMID: 26276817; PubMed_x000D_ Central PMCID: PMC4666966.
  • _x000D_ _x000D_ _x000D_
  • 14: Hurley MM, Adams DJ, Wang L, Jiang X, Burt PM, Du E, Xiao L. Accelerated_x000D_ fracture healing in transgenic mice overexpressing an anabolic isoform of_x000D_ fibroblast Growth Factor proteins 2. J Cell Biochem. 2016 Mar;117(3):599-611. doi:_x000D_ 10.1002/jcb.25308. PubMed PMID: 26252425.
  • _x000D_ _x000D_ _x000D_
  • 15: Li S, Payne S, Wang F, Claus P, Su Z, Groth J, Geradts J, de Ridder G,_x000D_ Alvarez R, Marcom PK, Pizzo SV, Bachelder RE. Nuclear basic fibroblast growth_x000D_ factor regulates triple-negative breast cancer chemo-resistance. Breast Cancer_x000D_ Res. 2015 Jul 4;17:91. doi: 10.1186/s13058-015-0590-3. PubMed PMID: 26141457;_x000D_ PubMed Central PMCID: PMC4491247.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human FGF2b Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products