Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now

Human TRAP1 Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameHuman TRAP1 Recombinant Protein
Uniprot IDQ12931
Uniprot linkhttp://www.uniprot.org/uniprot/Q12931
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMGSSHHHHHHSSGLVPRGSHMARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFS TQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPE MEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSR SAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWM MDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELGSSVALYSRKVLIQTKATDIL PKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQRLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEV KEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLR EFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARH FLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKA LERH
Molecular weight82,16 kDa
Protein delivered with Tag?Yes
Purity estimated>95%
BufferPBS, Urea 8M, imidazole 400mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Spec:Entrez GeneID10131
Spec:NCBI Gene AliasesHSP90L, HSP 75, HSP75, TRAP-1
Spec:SwissProtIDQ12931
NCBI ReferenceNP_057376.2
Aliases /SynonymsTRAP1, TNF Receptor-associated Protein 1 (TRAP1), heat shock protein 75 kDa
ReferencePX-P1164
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human TRAP1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade
Biosimilar

Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade

PX-TA1925 238$

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products