Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Plasmodium MSP1-p19 Recombinant Protein |
---|---|
Uniprot ID | X2J7U7 |
Uniprot link | http://www.uniprot.org/uniprot/X2J7U7 |
Origin species | Plasmodium |
Expression system | Prokaryotic expression |
Sequence | MGSSHHHHHHSSGMEVKIQKIKDNNNVQETIENLKKNKREGEDNYLYDSNNRTKKLSPNEHRNRKQLWTRFKQLRIVHENNMNSLFSNFDQQDLEQIYEDVSQHICINTVCPINSGCIRRLNGKEECRCLLNFKKEGMMCVPDENPTCEINNGGCDTTANCTSNGEQITCTCKLNKSFPIHQGIFCSSSNYLSLSFLLIIIFIYIT |
Molecular weight | 23.79 kDa |
Purity estimated | 80% |
Buffer | PBS, pH 7.5 |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Partial |
Protein Accession | AHN52397.1 |
Spec:SwissProtID | X2J7U7 |
NCBI Reference | AHN52397.1 |
Aliases /Synonyms | MSP1-p19, Merozoite surface protein 2 |
Reference | PX-P2080 |
Note | For research use only |
MSP1-p19 (Merozoite surface proteins) is a protein located on the surface of Plasmodium falciparum merozoites. The protein is a good target for vaccine development against malaria, a disease caused by protozoans because they are accessible to antibodies in the plasma. It also induce both inhibitory as well as blocking antibodies, the latter blocking the protective effects of the former. The malaria parasite, in its asexual, blood invading stage called the merozoite stage, infects red blood cells. The MSP1 complex of surface proteins likely mediates the first interactions of the parasite with red blood cells.
Send us a message from the form below
Reviews
There are no reviews yet.