Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Transcriptional regulator MraZ(mraZ) |
|---|---|
| Uniprot ID | B4TXG9 |
| Uniprot link | http://www.uniprot.org/uniprot/B4TXG9 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGMFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCLLLYPLPEWEIIEQKLSRLSSMNPV ERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGLTKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQD LSL |
| Molecular weight | 18.64kDa |
| Purity estimated | 85% by SDS-PAGE |
| Buffer | PBS, pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | full length |
| Reference | PX-P4518 |
| Note | For research use only |
The proximal end of the division and cell wall (dcw) gene cluster negatively regulates its own expression and subsequent gene expression. Works by directly binding to DNA. It can also regulate the expression of genes outside the dcw cluster
Send us a message from the form below
Reviews
There are no reviews yet.