Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Zebra fish MCM5Nter Recombinant Protein
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Zebra fish MCM5Nter Recombinant Protein |
|---|---|
| Uniprot ID | Q7ZTS7 |
| Uniprot link | http://www.uniprot.org/uniprot/Q7ZTS7 |
| Origin species | Zebra fish |
| Expression system | Prokaryotic expression |
| Sequence | MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRSAAGTIWEFALMSGFDDPGVYYSDSFGGGESVGDEGVVKRSQIK KKFREFLRQFRVGTDRTGFTYKYRDELKRHYTLGEYWIEVEMEDLASFDEDLSDCLYKLPAENLPLLEEAAQEVADEVTR PRPVGEETVQDIQVMLKSDAHPASIRSLKSEQVSRLVKIPGIIISSTAVRAKATRVCLQCRGCRAVISNIPLPPGLQGYA LPRKCNTEQAGRVKCPVDQLGCFGG |
| Molecular weight | 29,37 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 80% |
| Buffer | PBS pH6-8 containing Urea 6M and Imidazole 10mM |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | AAH44460.1 |
| Spec:SwissProtID | Q7ZTS7 |
| NCBI Reference | AAH44460.1 |
| Aliases /Synonyms | MCM5Nter, MCM5 minichromosome maintenance deficient 5 (S. cerevisiae) |
| Reference | PX-P1125 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.