Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | A. thaliana HSP17 Recombinant Protein |
---|---|
Uniprot ID | P19036 |
Uniprot link | http://www.uniprot.org/uniprot/P19036 |
Origin species | A. thaliana |
Expression system | Prokaryotic expression |
Sequence | MAHNHRHKHKLPRAMSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAPAKDVAAFTNAKVDWRETPEAHVFKADV PGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPKVQESK PEVKSVDISG |
Molecular weight | 19,11 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | >95% |
Buffer | PBS, imidazole 250mM, Urea 4M, pH 8.0 |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Full-length |
Protein Accession | NP_190209.1 |
Spec:Entrez GeneID | 823768 |
Spec:NCBI Gene Aliases | ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4, SMALL HEAT-SHOCK PROTEIN 17.4, ATHSP17.4 |
Spec:SwissProtID | P19036 |
NCBI Reference | NP_190209.1 |
Aliases /Synonyms | HSP17, heat shock protein 17.4, 17.4 kDa class I heat shock protein, 17.4 kDa heat shock protein 1, AtHsp17.4A |
Reference | PX-P1065 |
Note | For research use only |
Recombinant human HSP17, also known as Heat Shock 17.4 kDa class I heat shock protein. Heat shock proteins (HSP) are a family of proteins that are produced by cells in reaction to exposure to stressful environment. They can be expressed during exposure heat shock, to cold, UV light, and during wound healing or tissue remodeling. A lot of members from this group perform chaperone function by stabilizing new proteins to ensure correct folding or by helping to refold proteins that were damaged by the cell stress. This increase in expression is transcriptionally regulated.
Send us a message from the form below
Reviews
There are no reviews yet.