Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Annexin A2(ANXA2) |
---|---|
Uniprot ID | P07355 |
Uniprot link | https://www.uniprot.org/uniprot/P07355 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIA FAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEIN RVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISI MTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVL IRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD* |
Molecular weight | 38.61 kDa |
Protein delivered with Tag? | N terminus His tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH 7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Met1-Asp339 |
Protein Accession | P07355 |
Spec:Entrez GeneID | 302 |
Spec:NCBI Gene Aliases | P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270 |
Spec:SwissProtID | Q9UDH8 |
NCBI Reference | P07355 |
Aliases /Synonyms | Annexin II,Annexin-2,Calpactin I heavy chain,Calpactin-1 heavy chain,Chromobindin-8,Lipocortin II,Placental anticoagulant protein IV,PAP-IV ,Protein I,p36,ANX2, ANX2L4, CAL1H, LPC2D |
Reference | PX-P4794 |
Note | For research use only |
Related products
Send us a message from the form below
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.