Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Annexin A2(ANXA2)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P07355
Molecular weight:
38.61 kDa

$250.00

50ug + 250 loyalty points
Met1–Asp339 N terminus His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Annexin A2(ANXA2)

Annexin A2(ANXA2)

Product name Annexin A2(ANXA2)
Uniprot ID P07355
Uniprot link https://www.uniprot.org/uniprot/P07355
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIA FAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEIN RVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISI MTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVL IRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD*
Molecular weight 38.61 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp339
Protein Accession P07355
Spec:Entrez GeneID 302
Spec:NCBI Gene Aliases P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270
Spec:SwissProtID Q9UDH8
NCBI Reference P07355
Aliases /Synonyms Annexin II，Annexin-2，Calpactin I heavy chain，Calpactin-1 heavy chain，Chromobindin-8，Lipocortin II，Placental anticoagulant protein IV，PAP-IV ，Protein I，p36，ANX2, ANX2L4, CAL1H, LPC2D
Reference PX-P4794
Note For research use only
Molecular Constructor
Met1–Asp339 N terminus His
Product name Annexin A2(ANXA2)
Uniprot ID P07355
Uniprot link https://www.uniprot.org/uniprot/P07355
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIA FAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEIN RVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISI MTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVL IRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD*
Molecular weight 38.61 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp339
Protein Accession P07355
Spec:Entrez GeneID 302
Spec:NCBI Gene Aliases P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270
Spec:SwissProtID Q9UDH8
NCBI Reference P07355
Aliases /Synonyms Annexin II，Annexin-2，Calpactin I heavy chain，Calpactin-1 heavy chain，Chromobindin-8，Lipocortin II，Placental anticoagulant protein IV，PAP-IV ，Protein I，p36，ANX2, ANX2L4, CAL1H, LPC2D
Reference PX-P4794
Note For research use only
Molecular Constructor
Met1–Asp339 N terminus His

There are no reviews yet.

Be the first to review “Annexin A2(ANXA2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products