Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Kelch-like ECH-associated protein 1(KEAP1)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q14145
Molecular weight:
18.07 kDa

Original price was: $277.00.Current price is: $250.00.

50ug 10% OFF + 250 loyalty points
His Ala90–IIe250
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Kelch-like ECH-associated protein 1(KEAP1)

Product name PX-P4789-1MG
Uniprot ID Q14145
Uniprot link https://www.uniprot.org/uniprot/Q14145
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACI
Molecular weight 18.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala90-IIe250
Protein Accession Q14145
Spec:Entrez GeneID 9817
Spec:NCBI Gene Aliases INrf2; KLHL19
Spec:SwissProtID Q9BPY9
NCBI Reference Q14145
Aliases /Synonyms Cytosolic inhibitor of Nrf2; INrf2;Kelch-like protein 19
Reference PX-P4789
Note For research use only.
Molecular Constructor
His Ala90–IIe250
Product name Kelch-like ECH-associated protein 1(KEAP1)
Uniprot ID Q14145
Uniprot link https://www.uniprot.org/uniprot/Q14145
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVM YQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLIS RDDLNVRCESEVFHACI
Molecular weight 18.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala90-IIe250
Protein Accession Q14145
Spec:Entrez GeneID 9817
Spec:NCBI Gene Aliases INrf2; KLHL19
Spec:SwissProtID Q9BPY9
NCBI Reference Q14145
Aliases /Synonyms Cytosolic inhibitor of Nrf2; INrf2;Kelch-like protein 19
Reference PX-P4789
Note For research use only
Molecular Constructor
His Ala90–IIe250
Product name Kelch-like ECH-associated protein 1(KEAP1)
Uniprot ID Q14145
Uniprot link https://www.uniprot.org/uniprot/Q14145
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVM YQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLIS RDDLNVRCESEVFHACI
Molecular weight 18.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala90-IIe250
Protein Accession Q14145
Spec:Entrez GeneID 9817
Spec:NCBI Gene Aliases INrf2; KLHL19
Spec:SwissProtID Q9BPY9
NCBI Reference Q14145
Aliases /Synonyms Cytosolic inhibitor of Nrf2; INrf2;Kelch-like protein 19
Reference PX-P4789
Note For research use only
Molecular Constructor
His Ala90–IIe250

Kelch-like ECH-associated protein 1(KEAP1)

There are no reviews yet.

Be the first to review “Kelch-like ECH-associated protein 1(KEAP1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products