Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Transferrin receptor protein 1(TFRC)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P02786
Molecular weight:
27.59 kDa

$250.00

50ug + 250 loyalty points
Gln511–Gly751 N terminus His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Transferrin receptor protein 1(TFRC)

Product name Transferrin receptor protein 1(TFRC)
Uniprot ID P02786
Uniprot link https://www.uniprot.org/uniprot/P02786
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence QNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPE LNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATS RLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAF NETLFRNQLALATWTIQGAANALSG
Molecular weight 27.59 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln511-Gly751
Protein Accession P02786
Spec:Entrez GeneID 7037
Spec:NCBI Gene Aliases T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Spec:SwissProtID Q9UK21
NCBI Reference P02786
Aliases /Synonyms TR,TfR,TfR1,Trfr,T9,p90,CD_antigen: CD71
Reference PX-P4795
Note For research use only
Molecular Constructor
Gln511–Gly751 N terminus His
Product name Transferrin receptor protein 1(TFRC)
Uniprot ID P02786
Uniprot link https://www.uniprot.org/uniprot/P02786
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence QNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPE LNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATS RLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAF NETLFRNQLALATWTIQGAANALSG
Molecular weight 27.59 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln511-Gly751
Protein Accession P02786
Spec:Entrez GeneID 7037
Spec:NCBI Gene Aliases T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Spec:SwissProtID Q9UK21
NCBI Reference P02786
Aliases /Synonyms TR,TfR,TfR1,Trfr,T9,p90,CD_antigen: CD71
Reference PX-P4795
Note For research use only
Molecular Constructor
Gln511–Gly751 N terminus His

SDS-PAGE for Transferrin receptor protein 1 (TFRC)

SDS-PAGE for Transferrin receptor protein 1 (TFRC)

Transferrin receptor protein 1 (TFRC) on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein antibody is superior than 90 %.

Transferrin receptor protein 1(TFRC)

There are no reviews yet.

Be the first to review “Transferrin receptor protein 1(TFRC)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products