Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

MOR014824 Biosimilar – Anti-TSLP mAb – Research Grade

  • PX-TA1905-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2-kappa(Slience)

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

MOR014824 Biosimilar - Anti-TSLP mAb - Research Grade

Product name MOR014824 Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Species Homo sapiens
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TSLP,Thymic stromal lymphopoietin,
Reference PX-TA1905
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa(Slience)
Clonality Monoclonal Antibody
Product name MOR014824 Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Species Homo sapiens
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TSLP,Thymic stromal lymphopoietin,
Reference PX-TA1905
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa(Slience)
Clonality Monoclonal Antibody
Product name PX-TA1905-50
Uniprot ID Q969D9
Species Homo sapiens
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-TSLP,Thymic stromal lymphopoietin,
Reference PX-TA1905
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa(Slience)
Clonality Monoclonal Antibody

MOR014824 Biosimilar: A Promising Antibody for Treating TSLP-Mediated Diseases

MOR014824 Biosimilar is a monoclonal antibody (mAb) that specifically targets thymic stromal lymphopoietin (TSLP), a cytokine involved in various inflammatory and allergic diseases. This biosimilar is a highly effective and safe therapeutic option for patients suffering from TSLP-mediated disorders. In this article, we will delve into the structure, mechanism of action, and potential applications of MOR014824 Biosimilar.

Structure of MOR014824 Biosimilar

MOR014824 Biosimilar is a fully human mAb, meaning it is derived from human antibody-producing cells. It has a molecular weight of approximately 150 kDa and is composed of two identical heavy chains and two identical light chains. The heavy chains are made up of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains consist of one constant region (CL) and one variable region (VL). The VH and VL regions together form the antigen-binding site, which is responsible for the specificity of the antibody towards its target, TSLP.

Mechanism of Action

TSLP is a cytokine that plays a crucial role in the initiation and maintenance of allergic and inflammatory responses. It is produced by various cell types, including epithelial cells, mast cells, and dendritic cells. Upon binding to its receptor, TSLP activates a signaling cascade that leads to the production of pro-inflammatory cytokines, such as interleukin-4 (IL-4), IL-5, and IL-13.

MOR014824 Biosimilar works by binding to TSLP and preventing it from interacting with its receptor. This effectively blocks the downstream signaling pathway and reduces the production of pro-inflammatory cytokines. In addition, the binding of MOR014824 Biosimilar to TSLP also promotes the degradation of TSLP, further reducing its activity. This dual mechanism of action makes MOR014824 Biosimilar a potent and effective therapeutic agent for TSLP-mediated diseases.

Applications of MOR014824 Biosimilar

MOR014824 Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various TSLP-mediated diseases, including asthma, atopic dermatitis, and eosinophilic esophagitis. In a phase II clinical trial, MOR014824 Biosimilar was found to significantly improve lung function and reduce asthma exacerbations in patients with severe asthma. In another study, MOR014824 Biosimilar was shown to improve skin lesions and reduce itching in patients with atopic dermatitis.

In addition to these indications, MOR014824 Biosimilar has also shown potential in treating other TSLP-mediated diseases, such as chronic obstructive pulmonary disease (COPD), allergic rhinitis, and food allergies. Ongoing clinical trials are evaluating the efficacy and safety of MOR014824 Biosimilar in these conditions.

Conclusion

MOR014824 Biosimilar is a promising antibody therapy for TSLP-mediated diseases. Its unique structure and dual mechanism of action make it a highly effective and safe treatment option for patients suffering from these conditions. With ongoing research and clinical trials, MOR014824 Biosimilar has the potential to improve the lives of millions of people worldwide affected by TSLP-mediated disorders.

Research Grade Anti-Human TSLP (HU23B12) binds to Mouse TSLP recombinant protein in ELISA Assay

Research Grade Anti-Human TSLP (HU23B12) binds to Mouse TSLP recombinant protein in ELISA Assay

Mouse TSLP recombinant protein(cat. No.PX-P6400) at 0.5µg/mL (100µL/well) can bind Research Grade Anti-Human TSLP (HU23B12) in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Research Grade Anti-Human TSLP (HU23B12)

SDS-PAGE for Research Grade Anti-Human TSLP (HU23B12)

Research Grade Anti-Human TSLP (HU23B12), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

MOR014824 Biosimilar - Anti-TSLP mAb - Research Grade

There are no reviews yet.

Be the first to review “MOR014824 Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products