Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tezepelumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Tezepelumab ELISA Kit

Tezepelumab ELISA Kit

Product name Tezepelumab ELISA Kit
Uniprot ID Q969D9
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX270
Note For research use only.
Sample type Plasma, Serum
Target Tezepelumab
Immunogen Tezepelumab

Introduction to Tezepelumab ELISA Kit

Tezepelumab is a monoclonal antibody that has recently emerged as a promising therapeutic target for the treatment of respiratory diseases such as asthma and chronic obstructive pulmonary disease (COPD). This antibody specifically targets the thymic stromal lymphopoietin (TSLP) protein, which has been identified as a key player in the inflammatory cascade in these diseases. To aid in the detection and quantification of Tezepelumab, a highly sensitive and specific ELISA kit has been developed.

Structure of Tezepelumab

Tezepelumab is a fully human monoclonal antibody that belongs to the immunoglobulin G (IgG) class. It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 50 kDa. The antibody has a Y-shaped structure, with two antigen binding sites located at the tips of the Y. These binding sites are specific for the TSLP protein, allowing Tezepelumab to selectively bind to and inhibit its activity.

Activity of Tezepelumab

The main activity of Tezepelumab is its ability to block the interaction between TSLP and its receptor, thereby preventing downstream signaling and subsequent inflammatory responses. TSLP is a cytokine that is produced by epithelial cells in the lungs and has been shown to play a crucial role in the initiation and maintenance of allergic and inflammatory responses. By targeting TSLP, Tezepelumab can effectively inhibit the activation of various immune cells, including T cells, B cells, and dendritic cells, which are known to contribute to the pathogenesis of respiratory diseases.

Application of Tezepelumab ELISA Kit

The Tezepelumab ELISA kit is a valuable tool for the detection and quantification of Tezepelumab in various biological samples, including serum, plasma, and cell culture supernatant. This kit utilizes a sandwich enzyme-linked immunosorbent assay (ELISA) format, where the target antibody is captured by a specific TSLP-coated plate and then detected by a secondary antibody that is conjugated to an enzyme. The amount of Tezepelumab present in the sample is directly proportional to the signal generated by the enzyme, allowing for accurate and sensitive measurement of the antibody.

The Tezepelumab ELISA kit has several applications in both research and clinical settings. In research, it can be used to study the pharmacokinetics and pharmacodynamics of Tezepelumab, as well as its efficacy in various disease models. In clinical settings, the kit can be used to monitor Tezepelumab levels in patients receiving treatment, assess the response to therapy, and aid in dose optimization.

Conclusion

In summary, Tezepelumab ELISA kit is a valuable tool for the detection and quantification of Tezepelumab, a monoclonal antibody that specifically targets the TSLP protein. This kit has a high sensitivity and specificity, making it a reliable method for monitoring Tezepelumab levels in various biological samples. As Tezepelumab continues to show promising results in clinical trials, the Tezepelumab ELISA kit will play an important role in advancing our understanding of its mechanism of action and potential applications in the treatment of respiratory diseases.

Tezepelumab ELISA Kit

There are no reviews yet.

Be the first to review “Tezepelumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products