Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tezepelumab Biosimilar – Anti-TSLP mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG2-lambda

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tezepelumab Biosimilar - Anti-TSLP mAb - Research Grade

Product name Tezepelumab Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS 1572943-04-4
Species Homo sapiens
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tezepelumab,AMG 157,AMG-157,MEDI-9929,MEDI9929,anti-TSLP-Receptor (TSLP-R; Crl2),TSLP,anti-TSLP
Reference PX-TA1399
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name Tezepelumab Biosimilar - Anti-TSLP mAb - Research Grade
Uniprot ID Q969D9
Source CAS 1572943-04-4
Species Homo sapiens
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tezepelumab,AMG 157,AMG-157,MEDI-9929,MEDI9929,anti-TSLP-Receptor (TSLP-R; Crl2),TSLP,anti-TSLP
Reference PX-TA1399
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody
Product name PX-TA1399-50
Uniprot ID Q969D9
Source CAS 1572943-04-4
Species Homo sapiens
Raw Antigen Sequence MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tezepelumab,AMG 157,AMG-157,MEDI-9929,MEDI9929,anti-TSLP-Receptor (TSLP-R; Crl2),TSLP,anti-TSLP
Reference PX-TA1399
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-lambda
Clonality Monoclonal Antibody

General information on Anti-TSLP[Homo sapiens] (Tezepelumab) Monoclonal Antibody

Tezepelumab is investigated in the treatment of Oral Corticosteroid Dependent Asthma.

SDS-PAGE for Tezepelumab Biosimilar - Anti-TSLP mAb

SDS-PAGE for Tezepelumab Biosimilar - Anti-TSLP mAb

Tezepelumab Biosimilar - Anti-TSLP mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tezepelumab Biosimilar - Anti-TSLP mAb - Research Grade

There are no reviews yet.

Be the first to review “Tezepelumab Biosimilar – Anti-TSLP mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products