Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

SYN-005-1B7 Biosimilar – Anti-Pertussis toxin subunit 1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $372.00.Current price is: $308.00.

50ug 17% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

SYN-005-1B7 Biosimilar - Anti-Pertussis toxin subunit 1 mAb - Research Grade

Product name SYN-005-1B7 Biosimilar - Anti-Pertussis toxin subunit 1 mAb - Research Grade
Uniprot ID P04977
Source hu1B7, SYN-005, SYN-005-1B7
Species Humanized
Raw Antigen Sequence MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Pertussis toxin subunit 1,PTX S1,Islet-activating protein S1,IAP S1,NAD-dependent ADP-ribosyltransferase,ptxA,BP3783,hu1B7, SYN-005, SYN-005-1B7
Reference PX-TA1918
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name SYN-005-1B7 Biosimilar - Anti-Pertussis toxin subunit 1 mAb - Research Grade
Uniprot ID P04977
Source hu1B7, SYN-005, SYN-005-1B7
Species Humanized
Raw Antigen Sequence MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Pertussis toxin subunit 1,PTX S1,Islet-activating protein S1,IAP S1,NAD-dependent ADP-ribosyltransferase,ptxA,BP3783,hu1B7, SYN-005, SYN-005-1B7
Reference PX-TA1918
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1918-50
Uniprot ID P04977
Source hu1B7, SYN-005, SYN-005-1B7
Species Humanized
Raw Antigen Sequence MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Pertussis toxin subunit 1,PTX S1,Islet-activating protein S1,IAP S1,NAD-dependent ADP-ribosyltransferase,ptxA,BP3783,hu1B7, SYN-005, SYN-005-1B7
Reference PX-TA1918
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Title: SYN-005-1B7 Biosimilar: A Promising Antibody for Pertussis Treatment Introduction:

Pertussis, commonly known as whooping cough, is a highly contagious respiratory disease caused by the bacterium Bordetella pertussis. Despite the availability of vaccines, pertussis continues to be a major public health concern, with over 24 million cases and 160,000 deaths reported globally each year. Antibody-based therapies have shown promise in treating pertussis, and SYN-005-1B7 biosimilar is a novel monoclonal antibody (mAb) that targets the pertussis toxin subunit 1 (PTxS1). In this article, we will discuss the structure, activity, and potential applications of SYN-005-1B7 biosimilar as a therapeutic option for pertussis.

Structure of SYN-005-1B7 Biosimilar:

SYN-005-1B7 biosimilar is a recombinant, humanized IgG1 monoclonal antibody that specifically binds to PTxS1. It is produced using state-of-the-art recombinant DNA technology, resulting in a highly purified and stable product. The antibody has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains, each with a variable and constant region. The variable region of SYN-005-1B7 biosimilar is designed to bind specifically to PTxS1, while the constant region mediates effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of SYN-005-1B7 Biosimilar:

The primary mechanism of action of SYN-005-1B7 biosimilar is neutralization of PTxS1, a key virulence factor of B. pertussis. PTxS1 is responsible for the characteristic coughing and respiratory symptoms of pertussis, as well as the suppression of the immune response. By binding to PTxS1, SYN-005-1B7 biosimilar blocks its activity and prevents further damage to the respiratory tract. In addition, the antibody can also activate effector functions, leading to the elimination of B. pertussis bacteria and infected cells.

Potential Applications:

SYN-005-1B7 biosimilar has shown promising results in preclinical studies, demonstrating its potential as a therapeutic option for pertussis. The antibody has been shown to effectively neutralize PTxS1 in vitro and in animal models, reducing disease severity and mortality. Furthermore, SYN-005-1B7 biosimilar has also been shown to enhance the immune response against B. pertussis, leading to improved clearance of the bacteria. Based on these results, the biosimilar is currently being evaluated in clinical trials for the treatment of pertussis.

Conclusion:

In summary, SYN-005-1B7 biosimilar is a novel monoclonal antibody that specifically targets PTxS1, a key virulence factor of B. pertussis. Its unique structure and mechanism of action make it a promising therapeutic option for pertussis treatment. With ongoing clinical trials, SYN-005-1B7 biosimilar has the potential to improve the outcomes of pertussis patients and reduce the burden of this disease on a global scale.

SDS-PAGE for SYN-005-1B7 Biosimilar - Anti-ptxAPTXS1 mAb - Research Grade

SDS-PAGE for SYN-005-1B7 Biosimilar - Anti-ptxAPTXS1 mAb - Research Grade

SYN-005-1B7 Biosimilar - Anti-ptxAPTXS1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SYN-005-1B7 Biosimilar - Anti-Pertussis toxin subunit 1 mAb - Research Grade

There are no reviews yet.

Be the first to review “SYN-005-1B7 Biosimilar – Anti-Pertussis toxin subunit 1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products