Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Isotype | IgG2b |
| Applications | Elisa, WB |
| Host Species | Mouse |
| Clonality | Monoclonal Antibody |
| Target species | Anti-General Monoclonal Antibody |
| Brand | Arovia |
| Product name | Anti-Twin-Strep-tag(SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) Antibody (SAA0348) |
|---|---|
| Form | 0.01M PBS, pH 7.4. |
| Delivery condition | Blue ice (+4°C) |
| Storage condition | 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles |
| Brand | Arovia |
| Host species | Mouse |
| Reactivity | General |
| Reference | ARO-A14956 |
| Isotype | IgG2b |
| Clonality | Monoclonal Antibody |
| Purification | Protein A or G purified from cell culture supernatant. |
| Immunogen | Twin-Strep-tag, Twin Strep tag, TwinStrep tag,Streptag,Strep tag |
| Target species | Anti-General Monoclonal Antibody |
Send us a message from the form below
Reviews
There are no reviews yet.