Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD160 antigen(1-158) |
---|---|
Uniprot ID | O95971 |
Uniprot link | https://www.uniprot.org/uniprot/O95971 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH |
Molecular weight | 22.52kDa |
Purity estimated | >70% by SDS-PAGE |
Buffer | PBS, pH=7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1-Leu158 |
Aliases /Synonyms | Natural killer cell receptor BY55,CD_antigen: CD160,BY55,CD160-TM |
Reference | PX-P4287 |
Note | For research use only. |
The CD160 antigen is a protein encoded by the CD160 gene in humans. CD160 is a glycoprotein that was originally identified with the monoclonal antibody BY55. Its expression is strictly related to peripheral blood NK cells and cytolytically active CD8 T lymphocytes. The CD160 cDNA sequence can be predicted to be rich in 18-colored glycosylphosphatidylinositol amino acids, with a single Ig-like domain that is weakly homologous to the KIR2DL4 molecule. CD160 is expressed on the cell surface as a multimer with tightly bound disulfide bonds. Northern blot analysis showed that the CD160 mRNA was 1.5 and 1.6 kb, and its expression was very limited to circulating NK and T cells, spleen, and small intestine. In NK cells, CD160 is expressed by CD56dimCD16 + cells, while in circulating T cells, its expression is mainly limited to cells carrying TCRgd and TCRab + CD8brightCD95 + CD56 + CD28-CD27-CD27 cells. In tissue, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 exhibits broad specificity for the binding of classical and unconventional MHC class I molecules.
Send us a message from the form below
Reviews
There are no reviews yet.