Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD160 antigen(1-158)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O95971
Molecular weight:
22.52kDa

$250.00

50ug + 250 loyalty points
Met1–Leu158
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD160 antigen(1-158)

Product name CD160 antigen(1-194)
Uniprot ID O95971
Uniprot link https://www.uniprot.org/uniprot/O95971
Expression system Eukaryotic expression
Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH
Molecular weight 22.52kDa
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH=7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala194
Aliases /Synonyms Natural killer cell receptor BY55,CD_antigen: CD160,BY55,CD160-TM
Reference PX-P4287
Note For research use only
Molecular Constructor
Met1–Leu158
Product name CD160 antigen(1-194)
Uniprot ID O95971
Uniprot link https://www.uniprot.org/uniprot/O95971
Expression system Eukaryotic expression
Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH
Molecular weight 22.52kDa
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH=7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala194
Aliases /Synonyms Natural killer cell receptor BY55,CD_antigen: CD160,BY55,CD160-TM
Reference PX-P4287
Note For research use only
Molecular Constructor
Met1–Leu158

General information on CD160 antigen (CD160):

The CD160 antigen is a protein encoded by the CD160 gene in humans. CD160 is a glycoprotein that was originally identified with the monoclonal antibody BY55. Its expression is strictly related to peripheral blood NK cells and cytolytically active CD8 T lymphocytes. The CD160 cDNA sequence can be predicted to be rich in 18-colored glycosylphosphatidylinositol amino acids, with a single Ig-like domain that is weakly homologous to the KIR2DL4 molecule. CD160 is expressed on the cell surface as a multimer with tightly bound disulfide bonds. Northern blot analysis showed that the CD160 mRNA was 1.5 and 1.6 kb, and its expression was very limited to circulating NK and T cells, spleen, and small intestine. In NK cells, CD160 is expressed by CD56dimCD16 + cells, while in circulating T cells, its expression is mainly limited to cells carrying TCRgd and TCRab + CD8brightCD95 + CD56 + CD28-CD27-CD27 cells. In tissue, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 exhibits broad specificity for the binding of classical and unconventional MHC class I molecules.

There are no reviews yet.

Be the first to review “CD160 antigen(1-158)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products