Brand: ProteoGenix

Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein

PX-P3010-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q14508
Molecular weight:: 13.96 kDa

$250.00

50ug + 250 loyalty points

Full-length Yes

size size

50ug $250.00
100ug $500.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein

Product name	Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein
Uniprot ID	Q14508
Uniprot link	http://www.uniprot.org/uniprot/Q14508
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFGSHHHHHH
Molecular weight	13.96 kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Full-length
NCBI Reference	Q14508
Aliases /Synonyms	WFDC2, HE4, WAP5, EDDM4, Epididymal Protein 4, Epididymal Secretory Protein E4, Putative Protease Inhibitor WAP5, Major epididymis-specific protein E4
Reference	PX-P3010
Note	For research use only
Molecular Constructor	Full-length Yes

Product name	Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein
Uniprot ID	Q14508
Uniprot link	http://www.uniprot.org/uniprot/Q14508
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFGSHHHHHH
Molecular weight	13.96 kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Full-length
NCBI Reference	Q14508
Aliases /Synonyms	WFDC2, HE4, WAP5, EDDM4, Epididymal Protein 4, Epididymal Secretory Protein E4, Putative Protease Inhibitor WAP5, Major epididymis-specific protein E4
Reference	PX-P3010
Note	For research use only
Molecular Constructor	Full-length Yes

There are no reviews yet.

Be the first to review “Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein”

Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein

Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein

Specifications Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein

Documents

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein