Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Eosinophil cationic protein(ECP) Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P12724
Molecular weight:
44.53 kDa

Original price was: $367.00.Current price is: $308.00.

50ug 16% OFF + 308 loyalty points
Full-length
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Eosinophil cationic protein(ECP) Recombinant Protein

Product name Human Eosinophil cationic protein(ECP) Recombinant Protein
Uniprot ID P12724
Uniprot link http://www.uniprot.org/uniprot/P12724
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
Molecular weight 44.53 kDa
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference P12724
Aliases /Synonyms Rnase-A3, RnaseA3, ECP, RNS3, Ribonuclease,RNase A Family 3, Eosinophil Cationic Protein
Reference PX-P3057
Note For research use only
Molecular Constructor
Full-length
Product name Human Eosinophil cationic protein(ECP) Recombinant Protein
Uniprot ID P12724
Uniprot link http://www.uniprot.org/uniprot/P12724
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
Molecular weight 44.53 kDa
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference P12724
Aliases /Synonyms Rnase-A3, RnaseA3, ECP, RNS3, Ribonuclease,RNase A Family 3, Eosinophil Cationic Protein
Reference PX-P3057
Note For research use only
Molecular Constructor
Full-length
Product name PX-P3057-1MG
Uniprot ID P12724
Uniprot link http://www.uniprot.org/uniprot/P12724
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
Molecular weight 44.53 kDa
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference P12724
Aliases /Synonyms Rnase-A3, RnaseA3, ECP, RNS3, Ribonuclease,RNase A Family 3, Eosinophil Cationic Protein
Reference PX-P3057
Note For research use only
Molecular Constructor
Full-length

Human Eosinophil cationic protein(ECP) Recombinant Protein

  • Yu HY, Li XY, Cai ZF, Li L, Shi XZ, Song HX, Liu XJ. Eosinophil cationic protein mRNA expression in children with bronchial asthma. Genet Mol Res. 2015 Nov 13;14(4):14279-85. doi: 10.4238/2015.November.13.11. PubMed PMID: 26600485.
  • Elmose C, Sverrild A, van der Sluis S, Kyvik KO, Backer V, Thomsen SF. Genetic factors explain half of all variance in serum eosinophil cationic protein. Clin Exp Allergy. 2014 Dec;44(12):1525-30. doi: 10.1111/cea.12445. PubMed PMID: 25354326.
  • Sato T, Soga Y, Yamaguchi T, Meguro M, Maeda H, Tada J, Otani T, Seno M, Takashiba S. Cytokine expression in human dermal fibroblasts stimulated with eosinophil cationic protein measured by protein array. Asian Pac J Allergy Immunol. 2013 Dec;31(4):271-6. doi: 10.12932/AP0287.31.4.2013. PubMed PMID: 24383969.
  • Park SY, Oh S, Kim EJ, Yoon SY, Park HS, Yoon HS, Cho S. Utility of eosinophil cationic protein levels in the diagnosis of intrinsic atopic dermatitis. Acta Derm Venereol. 2014 May;94(3):333-4. doi: 10.2340/00015555-1715. PubMed PMID: 24129707.
  • Pulido D, Torrent M, Andreu D, Nogués MV, Boix E. Two human host defense ribonucleases against mycobacteria, the eosinophil cationic protein (RNase 3) and RNase 7. Antimicrob Agents Chemother. 2013 Aug;57(8):3797-805. doi: 10.1128/AAC.00428-13. Epub 2013 May 28. PubMed PMID: 23716047; PubMed Central PMCID: PMC3719706.
  • Kim KS, Won HR, Park CY, Hong JH, Lee JH, Lee KE, Cho HS, Kim HJ. Analyzing serum eosinophil cationic protein in the clinical assessment of chronic rhinosinusitis. Am J Rhinol Allergy. 2013 May-Jun;27(3):e75-80. doi: 10.2500/ajra.2013.27.3901. PubMed PMID: 23710948.
  • Rubin J, Venge P. Asparagine-linked glycans determine the cytotoxic capacity of eosinophil cationic protein (ECP). Mol Immunol. 2013 Oct;55(3-4):372-80. doi: 10.1016/j.molimm.2013.03.016. Epub 2013 Apr 15. PubMed PMID: 23597768.
  • Tas DA, Ozer HT, Erken E. Serum eosinophil cationic protein levels in Behçet's disease and its relation to clinical activity. Asian Pac J Allergy Immunol. 2013 Mar;31(1):67-72. PubMed PMID: 23517396.
  • Lien PC, Kuo PH, Chen CJ, Chang HH, Fang SL, Wu WS, Lai YK, Pai TW, Chang MD. In silico prediction and in vitro characterization of multifunctional human RNase3. Biomed Res Int. 2013;2013:170398. doi: 10.1155/2013/170398. Epub 2013 Jan 17. PubMed PMID: 23484086; PubMed Central PMCID: PMC3581242.
  • Gröger M, Bernt A, Wolf M, Mack B, Pfrogner E, Becker S, Kramer MF. Eosinophils and mast cells: a comparison of nasal mucosa histology and cytology to markers in nasal discharge in patients with chronic sino-nasal diseases. Eur Arch Otorhinolaryngol. 2013 Sep;270(10):2667-76. doi: 10.1007/s00405-013-2395-2. Epub 2013 Feb 22. PubMed PMID: 23430080.
  • Cheng KJ, Xu YY, Liu HY, Wang SQ. Serum eosinophil cationic protein level in Chinese subjects with nonallergic and local allergic rhinitis and its relation to the severity of disease. Am J Rhinol Allergy. 2013 Jan;27(1):8-12. doi: 10.2500/ajra.2013.27.3845. PubMed PMID: 23406588.
  • de Oliveira PC, de Lima PO, Oliveira DT, Pereira MC. Eosinophil cationic protein: overview of biological and genetic features. DNA Cell Biol. 2012 Sep;31(9):1442-6. doi: 10.1089/dna.2012.1729. Epub 2012 Jul 30. Review. PubMed PMID: 22845733.
  • Jin G, Mizutani A, Fukuda T, Chen L, Nakanishi K, Yan T, Kudoh T, Hirohata S, Kasai T, Murakami H, Salomon DS, Seno M. Eosinophil cationic protein enhances cardiomyocyte differentiation of P19CL6 embryonal carcinoma cells by stimulating the FGF receptor signaling pathway. Growth Factor proteinss. 2012 Oct;30(5):344-55. Epub 2012 Jul 31. PubMed PMID: 22845717.
  • Boix E, Pulido D, Moussaoui M, Nogués MV, Russi S. The sulfate-binding site structure of the human eosinophil cationic protein as revealed by a new crystal form. J Struct Biol. 2012 Jul;179(1):1-9. doi: 10.1016/j.jsb.2012.04.023. Epub 2012 May 9. PubMed PMID: 22579681.
  • Jung YG, Kim KH, Kim HY, Dhong HJ, Chung SK. Predictive capabilities of serum eosinophil cationic protein, percentage of eosinophils and total immunoglobulin E in allergic rhinitis without bronchial asthma. J Int Med Res. 2011;39(6):2209-16. PubMed PMID: 22289536.

There are no reviews yet.

Be the first to review “Human Eosinophil cationic protein(ECP) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products