Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade

  • PX-TA1912-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CM101 Biosimilar - Anti-MPIF2 mAb - Research Grade

Product name CM101 Biosimilar - Anti-MPIF2 mAb - Research Grade
Uniprot ID O00175
Source CM-101, CM101
Species Humanized
Raw Antigen Sequence MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-MPIF2,Eosinophil chemotactic protein 2,Small-inducible cytokine A24,CCL24,Eotaxin-2,SCYA24,MPIF-2,Myeloid progenitor inhibitory factor 2,CK-beta-6,C-C motif chemokine 24,CM-101, CM101
Reference PX-TA1912
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody
Product name CM101 Biosimilar - Anti-MPIF2 mAb - Research Grade
Uniprot ID O00175
Source CM-101, CM101
Species Humanized
Raw Antigen Sequence MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-MPIF2,Eosinophil chemotactic protein 2,Small-inducible cytokine A24,CCL24,Eotaxin-2,SCYA24,MPIF-2,Myeloid progenitor inhibitory factor 2,CK-beta-6,C-C motif chemokine 24,CM-101, CM101
Reference PX-TA1912
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody
Product name PX-TA1912-50
Uniprot ID O00175
Source CM-101, CM101
Species Humanized
Raw Antigen Sequence MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-MPIF2,Eosinophil chemotactic protein 2,Small-inducible cytokine A24,CCL24,Eotaxin-2,SCYA24,MPIF-2,Myeloid progenitor inhibitory factor 2,CK-beta-6,C-C motif chemokine 24,CM-101, CM101
Reference PX-TA1912
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG
Clonality Monoclonal Antibody

Introduction to CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade

CM101 Biosimilar – Anti-MPIF2 mAb is a novel biosimilar antibody that has been developed as a potential therapeutic agent for various inflammatory and autoimmune diseases. This research grade antibody is a highly specific and potent inhibitor of the protein MPIF2, which has been identified as a potential therapeutic target for a range of diseases. In this article, we will provide a detailed description of the structure, activity and potential applications of CM101 Biosimilar – Anti-MPIF2 mAb.

Structure of CM101 Biosimilar – Anti-MPIF2 mAb

CM101 Biosimilar – Anti-MPIF2 mAb is a monoclonal antibody that has been designed to specifically target the protein MPIF2. It is a recombinant antibody that is produced in a mammalian expression system. The antibody is composed of two heavy chains and two light chains, with a total molecular weight of approximately 150 kDa. The heavy chains consist of a constant region and a variable region, while the light chains consist of a constant region and a variable region. The variable regions of both the heavy and light chains are responsible for the specificity of the antibody towards MPIF2.

Activity of CM101 Biosimilar – Anti-MPIF2 mAb

The primary activity of CM101 Biosimilar – Anti-MPIF2 mAb is the inhibition of MPIF2, a chemokine that plays a crucial role in the recruitment and activation of inflammatory cells. By binding to MPIF2, the antibody prevents its interaction with its receptor, thereby blocking the downstream signaling pathways that lead to inflammation. This activity has been demonstrated in various preclinical studies, where CM101 Biosimilar – Anti-MPIF2 mAb has shown potent anti-inflammatory effects in various disease models.

Title: Applications of CM101 Biosimilar – Anti-MPIF2 mAb

CM101 Biosimilar – Anti-MPIF2 mAb has the potential to be used as a therapeutic agent for a range of inflammatory and autoimmune diseases. The primary therapeutic target for this antibody is diseases that involve excessive inflammation, such as rheumatoid arthritis, psoriasis, and inflammatory bowel disease. In addition, preclinical studies have also shown promising results in other diseases such as multiple sclerosis and asthma. The specificity and potency of CM101 Biosimilar – Anti-MPIF2 mAb make it a promising candidate for the treatment of these diseases.

Advantages of CM101 Biosimilar – Anti-MPIF2 mAb

One of the major advantages of CM101 Biosimilar – Anti-MPIF2 mAb is its biosimilarity to the reference antibody. This means that it has been developed to have similar structure, function, and activity to the original antibody, ensuring its safety and efficacy. Furthermore, as a research grade antibody, it is produced under strict quality control measures, ensuring its purity and consistency. This makes it a reliable tool for researchers studying the role of MPIF2 in various diseases.

Conclusion

In conclusion, CM101 Biosimilar – Anti-MPIF2 mAb is a novel biosimilar antibody with potent anti-inflammatory activity. Its specific targeting of MPIF2 makes it a promising therapeutic agent for various inflammatory and autoimmune diseases. The well-defined structure, activity, and potential applications of this antibody make it a valuable tool for researchers in the field of immunology and inflammation. Further clinical trials are needed to fully evaluate the therapeutic potential of CM101 Biosimilar – Anti-MPIF2 mAb, but the initial results are promising.

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade in ELISA Assay

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade in ELISA Assay

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade in WB Assay

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade in WB Assay

CM101 Biosimilar - Anti-CCL24;Eotaxin-2;MPIF-2 mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

CM101 Biosimilar - Anti-MPIF2 mAb - Research Grade

There are no reviews yet.

Be the first to review “CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products