Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Hnk20Mab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

  • PX-TA1083-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgA-nd

Original price was: $212.00.Current price is: $167.00.

50ug 21% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Hnk20Mab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade

Product name Hnk20Mab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade
Uniprot ID P03420
Species Mus musculus
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Hnk20Mab,HNK20,RSV glycoprotein F,anti-RSV glycoprotein F
Reference PX-TA1083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgA-nd
Clonality Monoclonal Antibody
Product name Hnk20Mab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade
Uniprot ID P03420
Species Mus musculus
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Hnk20Mab,HNK20,RSV glycoprotein F,anti-RSV glycoprotein F
Reference PX-TA1083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgA-nd
Clonality Monoclonal Antibody
Product name PX-TA1083-50
Uniprot ID P03420
Species Mus musculus
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Hnk20Mab,HNK20,RSV glycoprotein F,anti-RSV glycoprotein F
Reference PX-TA1083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgA-nd
Clonality Monoclonal Antibody

Introduction:

Hnk20Mab Biosimilar, also known as Anti-RSV glycoprotein F mAb, is a research grade monoclonal antibody that specifically targets the respiratory syncytial virus (RSV). This biosimilar is designed to mimic the structure and function of the naturally occurring Hnk20 antibody, which has shown promising results in preclinical studies for the treatment of RSV infections. In this article, we will explore the structure, activity, and potential applications of Hnk20Mab Biosimilar.

Structure:

Hnk20Mab Biosimilar is a monoclonal antibody that belongs to the immunoglobulin G (IgG) class. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region is responsible for binding to the RSV glycoprotein F, while the constant region determines the effector function of the antibody. Hnk20Mab Biosimilar has a molecular weight of approximately 150 kDa and is produced using recombinant DNA technology in mammalian cells.

Activity:

The primary function of Hnk20Mab Biosimilar is to bind to the RSV glycoprotein F, which is a key surface protein of the virus. This binding prevents the virus from entering and infecting host cells, thereby neutralizing its activity. Additionally, Hnk20Mab Biosimilar can also activate the immune system to recognize and eliminate RSV-infected cells. This dual mechanism of action makes Hnk20Mab Biosimilar a potent therapeutic agent against RSV.

Application:

Hnk20Mab Biosimilar has shown promising results in preclinical studies as a potential treatment for RSV infections. RSV is a common respiratory virus that can cause severe respiratory illness, especially in young children, older adults, and individuals with weakened immune systems. Currently, there is no specific treatment for RSV, and the available options are limited to supportive care. Hnk20Mab Biosimilar offers a targeted and potentially more effective approach to treating RSV infections.

In addition to its therapeutic potential, Hnk20Mab Biosimilar can also be used as a research tool for studying the structure and function of RSV glycoprotein F. Its ability to specifically bind to this protein makes it a valuable tool for understanding the virus and developing new treatments.

Future Directions:

Hnk20Mab Biosimilar is currently in the preclinical stage of development, and further studies are needed to determine its safety and efficacy in humans. If successful, it has the potential to be a game-changing treatment for RSV infections. In the future, Hnk20Mab Biosimilar may also be explored for its potential in preventing RSV infections in high-risk populations, such as infants and immunocompromised individuals.

Conclusion:

Hnk20Mab Biosimilar, also known as Anti-RSV glycoprotein F mAb, is a research grade monoclonal antibody with a specific target of the respiratory syncytial virus. Its unique structure and dual mechanism of action make it a promising therapeutic agent for the treatment of RSV infections. In addition, Hnk20Mab Biosimilar can also serve as a valuable research tool for studying RSV glycoprotein F. Further studies are needed to fully explore the potential of this biosimilar and its role in combating RSV infections.

SEC-HPLC of Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

SEC-HPLC of Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

SDS-PAGE for Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Hnk20Mab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade

There are no reviews yet.

Be the first to review “Hnk20Mab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products