Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nirsevimab ELISA Kit

Assay type:
Quantitative
Detection method:
Colorimetric
Recovery:
80-120%

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Nirsevimab ELISA Kit

Nirsevimab ELISA Kit

Product name Nirsevimab ELISA Kit
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Delivery condition Blue ice (+4°C)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX283
Note For research use only.
Sample type Plasma, Serum
Target Nirsevimab
Immunogen Nirsevimab
Assay type Quantitative
Detection method Colorimetric
Recovery 80-120%

Introduction

Nirsevimab is a novel monoclonal antibody that has shown promising results in the prevention of respiratory syncytial virus (RSV) infections in infants. It is currently being developed as a therapeutic target for the prevention of RSV infections in high-risk infants. In this article, we will discuss the structure, activity, and application of the Nirsevimab ELISA Kit, a diagnostic tool used for the detection of Nirsevimab in clinical samples.

Structure of Nirsevimab

Nirsevimab is a human monoclonal antibody that specifically targets the RSV fusion (F) protein. It is a 150 kDa glycoprotein that is composed of two heavy chains and two light chains. The heavy chains are made up of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of one constant domain (CL) and one variable domain (VL). The VH and VL domains together form the antigen-binding site of the antibody, which is responsible for its specificity towards the RSV F protein.

Activity of Nirsevimab

Nirsevimab works by binding to the RSV F protein and preventing its fusion with the host cell membrane. This prevents the virus from entering the host cell and replicating, thereby reducing the severity of the infection. Nirsevimab has been shown to have a high affinity for the RSV F protein and is able to neutralize a broad range of RSV strains, including those that are resistant to other RSV antibodies. It also has a longer half-life compared to other RSV antibodies, allowing for a longer duration of protection.

Application of Nirsevimab ELISA Kit

The Nirsevimab ELISA Kit is a diagnostic tool that is used for the detection of Nirsevimab in clinical samples. It is based on the principle of enzyme-linked immunosorbent assay (ELISA), which involves the use of specific antibodies to detect and quantify the presence of a target molecule in a sample. The kit contains all the necessary reagents and materials for the detection of Nirsevimab, including the coated plates, detection antibodies, and standards.
The Nirsevimab ELISA Kit has several applications in the research field. It can be used to measure the levels of Nirsevimab in serum or plasma samples from patients who have received the antibody as a prophylactic treatment. This can help researchers understand the pharmacokinetics of Nirsevimab and its efficacy in preventing RSV infections. The kit can also be used to compare the levels of Nirsevimab in different patient populations, such as premature infants or those with underlying medical conditions, to assess its effectiveness in these high-risk groups.
Furthermore, the Nirsevimab ELISA Kit can be used in preclinical studies to evaluate the pharmacokinetics and pharmacodynamics of Nirsevimab in animal models. This can provide valuable information for the development of optimized dosing regimens for human clinical trials. Additionally, the kit can be used to measure the levels of Nirsevimab in breast milk, which can help determine the potential transfer of the antibody from mother to infant during breastfeeding.

Conclusion

The Nirsevimab ELISA Kit is a valuable tool for the detection and quantification of Nirsevimab in clinical samples. It is based on the specific binding of Nirsevimab to the RSV F protein and has several applications in research, including the evaluation of its pharmacokinetics, efficacy, and safety. With its high specificity and sensitivity, the Nirsevimab ELISA Kit is an important tool in the development and evaluation of this promising therapeutic target for the prevention of RSV infections in infants.

Nirsevimab ELISA Kit

There are no reviews yet.

Be the first to review “Nirsevimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products