Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody for Research

Isotype:
IgG1, kappa

Original price was: $121.00.Current price is: $100.00.

50ug 17% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody for Research

Product name Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody for Research
Uniprot ID P03420
Source CAS 1989556-22-0
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Nirsevimab, MEDI-8897, RSV, anti-RSV, Nirsevimab Biosimilar
Reference PX-TA1530
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody for Research
Uniprot ID P03420
Source CAS 1989556-22-0
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Nirsevimab, MEDI-8897, RSV, anti-RSV, Nirsevimab Biosimilar
Reference PX-TA1530
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name PX-TA1530-50
Uniprot ID P03420
Source CAS 1989556-22-0
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Nirsevimab, MEDI-8897, RSV, anti-RSV, Nirsevimab Biosimilar
Reference PX-TA1530
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Product name Nirsevimab Biosimilar - Anti-RSV mAb - Research Grade
Uniprot ID P03420
Source CAS 1989556-22-0
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Nirsevimab,MEDI-8897,RSV,anti-RSV
Reference PX-TA1530
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Nirsevimab Biosimilar - Anti-RSV mAb - Research Grade
Uniprot ID P03420
Source CAS 1989556-22-0
Species Humanized
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Nirsevimab,MEDI-8897,RSV,anti-RSV
Reference PX-TA1530
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody

Introduction to Nirsevimab Biosimilar – Anti-RSV mAb – Research Grade

Nirsevimab Biosimilar, also known as Anti-RSV mAb, is a novel monoclonal antibody (mAb) that has shown promising results in the treatment of respiratory syncytial virus (RSV) infections. This biosimilar is a research grade version of the original Nirsevimab, which is currently in clinical trials for the prevention of RSV infections in infants.

Structure of Nirsevimab Biosimilar

Nirsevimab Biosimilar is a recombinant humanized mAb that is produced in Chinese hamster ovary (CHO) cells. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains have two constant domains (CL and CL2) and one variable domain (VL).

The variable domains of Nirsevimab Biosimilar are responsible for its specificity and binding to the RSV fusion (F) protein. This protein is essential for the virus to enter and infect host cells, making it a crucial therapeutic target for RSV infections.

Mechanism of Action

Nirsevimab Biosimilar works by binding to the RSV F protein and preventing it from fusing with the host cell membrane. This inhibits the virus from entering the cell and replicating, ultimately stopping the infection from spreading. Additionally, the mAb also triggers an immune response that helps in clearing the virus from the body.

Application of Nirsevimab Biosimilar

Nirsevimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the prevention of RSV infections in infants. RSV is a common respiratory virus that can cause severe respiratory illness in young children, especially those with underlying health conditions. Currently, there is no approved vaccine or effective treatment for RSV, making Nirsevimab Biosimilar a potential game-changer in the field of respiratory infections.

Advantages of Nirsevimab Biosimilar

Compared to other mAbs targeting RSV, Nirsevimab Biosimilar has several advantages. Firstly, it has a longer half-life, allowing for less frequent dosing. This is particularly beneficial for infants who are at high risk of RSV infections and may require multiple doses during the RSV season. Secondly, it has a higher binding affinity to the RSV F protein, making it more effective in preventing viral entry into host cells. Lastly, Nirsevimab Biosimilar has a favorable safety profile, with no serious adverse events reported in clinical trials so far.

Conclusion

In conclusion, Nirsevimab Biosimilar is a promising therapeutic option for the prevention of RSV infections in infants. Its unique structure, mechanism of action, and potential advantages make it a highly sought-after treatment in the field of respiratory infections. With ongoing clinical trials, we can hope to see this biosimilar being approved for use in the near future, providing a much-needed solution for the prevention of RSV infections.

What is the price of Nirsevimab biosimilar?

The price of the Nirsevimab biosimilar depends on the selected size and format. Current pricing is displayed directly on the product page for each available quantity.

Nirsevimab biosimilar anti-RSV F protein antibody SDS-PAGE validation

Nirsevimab biosimilar anti-RSV F protein antibody SDS-PAGE validation

Nirsevimab Biosimilar - Anti-Fusion glycoprotein F0 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

ELISA binding of Nirsevimab biosimilar to HRSV-A2 prefusion F protein

ELISA binding of Nirsevimab biosimilar to HRSV-A2 prefusion F protein

Immobilized HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein (cat. No.PX-P6126) at 0.5µg/mL (100µL/well) can bind Nirsevimab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade (cat. No.PX-TA1530) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 8.851M.

Nirsevimab Biosimilar – Anti-RSV Monoclonal Antibody for Research

  • Taylor Slade-Adjei — August 14, 2024

    The shipping and customer service is always exceptional!

  • jurata-orders — August 14, 2024

    Solid mAb choice for assay development.

  • Denise Reaves — August 14, 2024

    It’s pretty weak, recommend high concentrations when using in neutralization assay

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products