Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein

  • PX-P6126
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
HRSV-A2
Uniprot ID:
P03420
Molecular weight:
63.15 kDa

$500.00

100ug + 500 loyalty points
Met1–Leu513 amp; C-Strep His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein

Product name HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein
Uniprot ID P03420
Origin species HRSV-A2
Expression system Eukaryotic expression
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELL
Molecular weight 63.15 kDa
Protein delivered with Tag? C-Terminal His & C-Strep Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Leu513
Aliases /Synonyms F, Fusion glycoprotein F0, Fusion glycoprotein F2, p27, Intervening segment, Pep27, Peptide 27, Fusion glycoprotein F1, Drug Target,Human Respiratory Syncytial Virus (HRSV), RSV
Reference PX-P6126
Note For research use only.
Molecular Constructor
Met1–Leu513 amp; C-Strep His

Palivizumab Biosimilar - Anti-RSV mAb binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in indirect ELISA Assay

Palivizumab Biosimilar - Anti-RSV mAb binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in indirect ELISA Assay

Immobilized HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein (cat. No.PX-P6126) at 0.5µg/mL (100µL/well) can bind to Palivizumab Biosimilar - Anti-RSV mAb (cat. No.PX-TA1057) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Nirsevimab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in ELISA assay

Nirsevimab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in ELISA assay

Immobilized HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein (cat. No.PX-P6126) at 0.5µg/mL (100µL/well) can bind Nirsevimab Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade (cat. No.PX-TA1530) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 8.851M.

Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in indirect ELISA Assay

Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb binds to HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein in indirect ELISA Assay

Immobilized HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein (cat. No.PX-P6126) at 0.5µg/mL (100µL/well) can bind to Suptavumab Biosimilar - Anti-RSV glycoprotein F mAb (cat. No.PX-TA1429) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein

There are no reviews yet.

Be the first to review “HRSV-A2 Pre-F-Fusion glycoprotein F0 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products