Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Adalimumab Biosimilar – Anti-TNF alpha mAb – Research Grade

Isotype:
IgG1

Original price was: $121.00.Current price is: $100.00.

50ug 17% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade

Product name PX-TA1001-50
Uniprot ID P01375
Source DrugBank DB00051
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Adalimumab,Adalimumab,TNF alpha,anti-TNF alpha
Reference PX-TA1001
Note For research use only. Not suitable for human use.
Isotype IgG1
Product name Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00051
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Adalimumab,Adalimumab,TNF alpha,anti-TNF alpha
Reference PX-TA1001
Note For research use only. Not suitable for human use.
Isotype IgG1
Product name Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00051
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Adalimumab,Adalimumab,TNF alpha,anti-TNF alpha
Reference PX-TA1001
Note For research use only. Not suitable for human use.
Isotype IgG1
Product name Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00051
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Adalimumab,Adalimumab,TNF alpha,anti-TNF alpha
Reference PX-TA1001
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00051
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Adalimumab,Adalimumab,TNF alpha,anti-TNF alpha
Reference PX-TA1001
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

Adalimumab is a human IgG1 monoclonal antibody that is recombinant and that targets against tumor necrosis factor-alpha (TNF-alpha). This antibody has immunomodulating properties. Adalimumab attaches to TNF-alpha, effectively blocking its interaction with the p55 and p75 TNF cell surface receptors, consequently hindering TNF-mediated immune reactions. TNF-alpha, is an inflammatory cytokine. It is especially involved in autoimmune conditions.

Adalimumab Biosimilar - Anti-TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Adalimumab Biosimilar - Anti-TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Adalimumab Biosimilar - Anti-TNF alpha mAb (cat. No.PX-TA1001) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 142.1M.

SDS-PAGE for Adalimumab Biosimilar - Anti-TNF alpha mAb

SDS-PAGE for Adalimumab Biosimilar - Anti-TNF alpha mAb

Adalimumab Biosimilar - Anti-TNF alpha mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade

  • Ofer Gover — December 14, 2021

    We used this ab to reduce as a negative control for reducing caco-2 (IEC) cells exitation by exugenues TNFa. We measured IL8 secreation as a result of TNFa stimulation. 1ug/mL ofAdalimumab Biosimilar – Anti-TNF alpha mAb was enough to completly abolish IL8 secreation by TNFa stimulation in caco-2 cells.

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products