Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human TNFa Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01375
Molecular weight:
18.56 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay
Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay
Infliximab Biosimilar - Anti-TNF-alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay
Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Human TNFa Recombinant Protein

Product name Human TNFa Recombinant Protein
Uniprot ID P01375
Uniprot link http://www.uniprot.org/uniprot/P01375
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MGSHHHHHHSGVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGC PSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQ VYFGIIAL
Molecular weight 18.56 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
NCBI Reference P01375
Aliases /Synonyms DIF, TNF-A, TNFSF2, Cachectin, Tumor Necrosis Factor Ligand Superfamily Member 2,Tumor Necrosis Factor Alpha, TNFa, cachexin
Reference PX-P3058
Note For research use only
Molecular Constructor
Partial Yes
Product name Human TNFa Recombinant Protein
Uniprot ID P01375
Uniprot link http://www.uniprot.org/uniprot/P01375
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MGSHHHHHHSGVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGC PSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQ VYFGIIAL
Molecular weight 18.56 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Partial
NCBI Reference P01375
Aliases /Synonyms DIF, TNF-A, TNFSF2, Cachectin, Tumor Necrosis Factor Ligand Superfamily Member 2,Tumor Necrosis Factor Alpha, TNFa, cachexin
Reference PX-P3058
Note For research use only
Molecular Constructor
Partial Yes

Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay

Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade (cat. No.PX-TA1024) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 105.9M.

Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay

Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Adalimumab Biosimilar - Anti-TNF alpha mAb - Research Grade (cat. No.PX-TA1001) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 142.1M.

Infliximab Biosimilar - Anti-TNF-alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Infliximab Biosimilar - Anti-TNF-alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Infliximab Biosimilar - Anti-TNF-alpha mAb (cat. No.PX-TA1009) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 60.68M.

Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Golimumab Biosimilar - Anti-TNFA, TNF alpha mAb (cat. No.PX-TA1129) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.028M.

There are no reviews yet.

Be the first to review “Human TNFa Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products