Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

  • PX-TA1219-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: $218.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Nerelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Product name Nerelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Source CAS 162774-06-3
Species Mus musculus
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Nerelimomab,BAYX1351,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1219
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Nerelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Source CAS 162774-06-3
Species Mus musculus
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Nerelimomab,BAYX1351,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1219
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1219-50
Uniprot ID P01375
Source CAS 162774-06-3
Species Mus musculus
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Nerelimomab,BAYX1351,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1219
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction

Nerelimomab Biosimilar, also known as Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade, is a novel monoclonal antibody that targets the tumor necrosis factor superfamily member 2 (TNFSF2), also known as TNF-alpha. This biosimilar is a promising therapeutic option for various inflammatory and autoimmune diseases, as well as certain types of cancer. In this article, we will discuss the structure, activity and potential applications of Nerelimomab Biosimilar in detail.

Structure of Nerelimomab Biosimilar

Nerelimomab Biosimilar is a recombinant humanized monoclonal antibody that is produced using advanced genetic engineering techniques. It is composed of two heavy chains and two light chains, each consisting of variable and constant regions. The variable regions of the antibody are responsible for binding to the target TNF-alpha, while the constant regions play a role in immune effector functions.

Activity of Nerelimomab Biosimilar

TNF-alpha is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various diseases, including rheumatoid arthritis, psoriasis, Crohn’s disease, and multiple sclerosis. It is also involved in the progression of certain types of cancer. Nerelimomab Biosimilar works by binding to TNF-alpha and preventing its interaction with its receptors, thereby inhibiting its pro-inflammatory effects. This leads to a decrease in the production of other inflammatory mediators and a reduction in disease symptoms.

Applications of Nerelimomab Biosimilar

Nerelimomab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various inflammatory and autoimmune diseases. It has been evaluated in patients with rheumatoid arthritis, psoriasis, Crohn’s disease, and multiple sclerosis, and has demonstrated significant improvements in disease symptoms. Additionally, Nerelimomab Biosimilar has also shown potential as an adjuvant therapy for certain types of cancer, including breast cancer and lung cancer.

Anti-inflammatory effects

The anti-inflammatory effects of Nerelimomab Biosimilar make it a promising therapeutic option for various inflammatory diseases. By inhibiting TNF-alpha, it can reduce the production of other pro-inflammatory cytokines and chemokines, thereby decreasing inflammation and tissue damage. This can lead to a significant improvement in symptoms and disease progression.

Immunomodulatory effects

Apart from its anti-inflammatory effects, Nerelimomab Biosimilar also has immunomodulatory properties. It can regulate the activity of immune cells, such as T cells, B cells, and macrophages, which play a crucial role in the pathogenesis of autoimmune diseases. This can help in maintaining immune homeostasis and preventing the development of autoimmunity.

Potential as a combination therapy

Nerelimomab Biosimilar has also shown potential as a combination therapy with other anti-inflammatory drugs. In a clinical study, it was found to have a synergistic effect when used in combination with methotrexate, a commonly used drug for rheumatoid arthritis. This suggests that Nerelimomab Biosimilar can be used in combination with other therapies to enhance its efficacy and reduce the risk of adverse effects.

Conclusion

In conclusion, Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade is a promising therapeutic option for various inflammatory and autoimmune diseases, as well as certain types of cancer. Its unique structure and mechanism of action make it a potent anti-inflammatory and immunomodulatory agent. With ongoing research and clinical trials, Nerelimomab Biosimilar has the potential to improve the treatment outcomes of patients suffering from these diseases.

Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in ELISA Assay

Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in ELISA Assay

Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade

Flow Cytometry results for Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Nerelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Nerelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products