Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

CD120a Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P19438
Molecular weight:
30kDa

$380.00

100ug + 380 loyalty points
Met1~Thr211 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
CD120a Recombinant Protein

CD120a Recombinant Protein

Product name CD120a Recombinant Protein
Uniprot ID P19438
Uniprot link http://www.uniprot.org/uniprot/P19438
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Sequence MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Molecular weight 30kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Thr211
Aliases /Synonyms TNFAR, TNFR1
Reference PX-P4100
Note For research use only
Background information Array
Molecular Constructor
Met1~Thr211 His

General information on CD120a Recombinant Protein

Structure

CD120a Recombinant Protein is a type I transmembrane glycoprotein, also known as tumor necrosis factor receptor (TNFR). It is composed of an extracellular domain, a transmembrane domain, and an intracellular domain.

Activity

CD120a is an antibody-drug target for the treatment of various diseases, such as autoimmunity, cancer, and chronic inflammation. It is involved in the regulation of cytokine proteins, including TNF, which are involved in inflammation and immune response.

Application

CD120a Recombinant Protein is used in research and drug development for the treatment of various diseases. It can be used to study the structure and function of the TNFR and to develop drugs that target this receptor. Additionally, it can be used to study the mechanism of action of cytokines and their role in inflammation and immunity.

There are no reviews yet.

Be the first to review “CD120a Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products