Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade

  • PX-TA1362-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
[VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Product name Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID Q16552 & P01375
Source CAS 1791410-27-9
Species Homo sapiens
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Remtolumab,A-1230717,ABT-122,IL17A, TNFSF2, TNF-alpha, TNFA,anti-IL17A, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1362
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer
Clonality Monoclonal Antibody
Product name Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID Q16552 & P01375
Source CAS 1791410-27-9
Species Homo sapiens
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Remtolumab,A-1230717,ABT-122,IL17A, TNFSF2, TNF-alpha, TNFA,anti-IL17A, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1362
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer
Clonality Monoclonal Antibody
Product name PX-TA1362-50
Uniprot ID Q16552 & P01375
Source CAS 1791410-27-9
Species Homo sapiens
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Remtolumab,A-1230717,ABT-122,IL17A, TNFSF2, TNF-alpha, TNFA,anti-IL17A, TNFSF2, TNF-alpha, TNFA
Reference PX-TA1362
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype [VH-VH'-H-Gamma1-VL-VL'-C-kappa]-dimer
Clonality Monoclonal Antibody

General information on Anti-IL17A/TNFSF2/TNF-alpha/TNFA[Homo sapiens] (Remtolumab) Monoclonal Antibody

Remtolumab is investigated for the treatment of Rheumatoid Arthritis.

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade in ELISA Assay

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade in ELISA Assay

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Remtolumab Biosimilar - Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products