Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Remtolumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Remtolumab ELISA Kit

Remtolumab ELISA Kit

Product name Remtolumab ELISA Kit
Uniprot ID Q16552 & P01375
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX260
Note For research use only.
Sample type Plasma, Serum
Target Remtolumab
Immunogen Remtolumab

Introduction to Remtolumab ELISA Kit

Remtolumab ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) kit used for the detection and quantification of remtolumab in various biological samples. Remtolumab, also known as anti-CD20 antibody, is a monoclonal antibody that specifically targets CD20, a cell surface protein found on B-lymphocytes. It has been extensively studied and is considered a promising therapeutic target for the treatment of various diseases, including B-cell lymphomas and autoimmune disorders.

Structure of Remtolumab

Remtolumab is a fully humanized IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region of remtolumab is responsible for binding to the CD20 antigen, while the constant region is responsible for effector functions such as complement activation and antibody-dependent cellular cytotoxicity (ADCC).

The three-dimensional structure of remtolumab has been extensively studied using techniques such as X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy. These studies have revealed the precise binding sites of remtolumab on CD20, providing valuable insights into the mechanism of action of this therapeutic antibody.

Activity of Remtolumab

Remtolumab exerts its therapeutic activity by binding to CD20 on the surface of B-cells and inducing their destruction through various mechanisms. One of the main mechanisms of action is ADCC, where the Fc region of remtolumab binds to Fc receptors on immune cells, such as natural killer (NK) cells, leading to the lysis of CD20-positive B-cells.

In addition, remtolumab also activates the complement system, which is a part of the innate immune response. The binding of remtolumab to CD20 triggers the classical complement pathway, resulting in the formation of a membrane attack complex that leads to the lysis of B-cells.

Moreover, remtolumab has been shown to induce apoptosis (programmed cell death) in CD20-positive B-cells. This mechanism is thought to be mediated by the binding of remtolumab to CD20, which activates signaling pathways that ultimately lead to cell death.

Application of Remtolumab ELISA Kit

The Remtolumab ELISA Kit is a valuable tool for the detection and quantification of remtolumab in various biological samples. It has been extensively used in clinical trials to monitor the levels of remtolumab in patient serum or plasma, which can provide valuable information about the drug’s pharmacokinetics and pharmacodynamics.

In addition, the Remtolumab ELISA Kit can also be used to measure the levels of remtolumab in cell culture supernatants, allowing for the optimization of cell-based assays and the evaluation of remtolumab production in bioprocessing systems.

Furthermore, the Remtolumab ELISA Kit can be used in preclinical studies to assess the pharmacokinetic and pharmacodynamic properties of remtolumab in animal models. This information is crucial for the development of dosing regimens and for predicting the potential efficacy of remtolumab in human patients.

Conclusion

The Remtolumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of remtolumab, a promising therapeutic antibody targeting CD20. Its application in clinical and preclinical studies has provided valuable insights into the structure, activity, and potential therapeutic applications of remtolumab. With the increasing interest in remtolumab as a therapeutic target, the Remtolumab ELISA Kit will continue to play a crucial role in the development and monitoring of this promising drug.

Remtolumab ELISA Kit

There are no reviews yet.

Be the first to review “Remtolumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products