Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interleukin-17A(IL17A)

Host species:
Mammalian cells
Uniprot ID:
Q16552
Molecular weight:
18.5kDa

$250.00

50ug + 250 loyalty points
Met1–Ala155 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-17A(IL17A)

Product name Interleukin-17A(IL17A)
Uniprot ID Q16552
Uniprot link https://www.uniprot.org/uniprot/Q16552
Expression system Eukaryotic expression
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGSHHHHHH
Molecular weight 18.5kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >60% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala155
Protein Accession Q16552
Spec:Entrez GeneID 3605
Spec:NCBI Gene Aliases IL17; CTLA8; IL-17; CTLA-8; IL-17A
Spec:SwissProtID Q5T2P0
NCBI Reference Q16552
Aliases /Synonyms Cytotoxic T-lymphocyte-associated antigen 8,CTLA-8,CTLA8, IL17,IL-17, IL-17A
Reference PX-P4824
Note For research use only
Molecular Constructor
Met1–Ala155 His
Product name Interleukin-17A(IL17A)
Uniprot ID Q16552
Uniprot link https://www.uniprot.org/uniprot/Q16552
Expression system Eukaryotic expression
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGSHHHHHH
Molecular weight 18.5kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >60% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ala155
Protein Accession Q16552
Spec:Entrez GeneID 3605
Spec:NCBI Gene Aliases IL17; CTLA8; IL-17; CTLA-8; IL-17A
Spec:SwissProtID Q5T2P0
NCBI Reference Q16552
Aliases /Synonyms Cytotoxic T-lymphocyte-associated antigen 8,CTLA-8,CTLA8, IL17,IL-17, IL-17A
Reference PX-P4824
Note For research use only
Molecular Constructor
Met1–Ala155 His

There are no reviews yet.

Be the first to review “Interleukin-17A(IL17A)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products