Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vunakizumab Biosimilar – Anti-IL17A mAb – Research Grade

  • PX-TA1444-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade

Product name Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1792181-33-9
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vunakizumab,SHR-1314,IL17A,anti-IL17A
Reference PX-TA1444
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1792181-33-9
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vunakizumab,SHR-1314,IL17A,anti-IL17A
Reference PX-TA1444
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1444-50
Uniprot ID Q16552
Source CAS 1792181-33-9
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vunakizumab,SHR-1314,IL17A,anti-IL17A
Reference PX-TA1444
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Vunakizumab Biosimilar, also known as Anti-IL17A mAb, is a research grade antibody that targets the cytokine IL-17A. This antibody has shown promising results in preclinical studies and is currently being developed as a potential therapeutic agent for various inflammatory and autoimmune diseases.

Structure of Vunakizumab Biosimilar

Vunakizumab Biosimilar is a monoclonal antibody (mAb) that is produced using recombinant DNA technology. It is a fully humanized IgG1 antibody, meaning it is derived from human genes and has a constant region of the IgG1 isotype. The antibody has a molecular weight of approximately 150 kDa and contains two heavy chains and two light chains, connected by disulfide bonds. The variable region of the antibody is responsible for binding to its target, IL-17A.

Activity of Vunakizumab Biosimilar

Vunakizumab Biosimilar specifically targets the cytokine IL-17A, which is a pro-inflammatory cytokine involved in the pathogenesis of various autoimmune and inflammatory diseases. IL-17A is produced by a subset of T cells called Th17 cells and has been implicated in diseases such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. Vunakizumab Biosimilar binds to IL-17A with high affinity, preventing it from binding to its receptor and exerting its pro-inflammatory effects. This leads to a decrease in inflammation and potentially improved disease outcomes.

Application of Vunakizumab Biosimilar

Vunakizumab Biosimilar is currently being studied as a potential therapeutic agent for various inflammatory and autoimmune diseases. Preclinical studies have shown promising results in animal models of psoriasis, rheumatoid arthritis, and multiple sclerosis. The antibody has also been shown to be well-tolerated in human clinical trials.

Psoriasis

Psoriasis is a chronic inflammatory skin disease characterized by red, scaly plaques on the skin. IL-17A has been identified as a key cytokine in the pathogenesis of psoriasis, and Vunakizumab Biosimilar has shown promising results in preclinical studies as a potential treatment for this condition. In a mouse model of psoriasis, treatment with Vunakizumab Biosimilar led to a significant reduction in skin inflammation and improved disease severity.

Rheumatoid Arthritis

Rheumatoid arthritis (RA) is an autoimmune disease characterized by chronic inflammation of the joints. IL-17A has been implicated in the pathogenesis of RA, and Vunakizumab Biosimilar has shown potential as a treatment for this condition. In a preclinical study, treatment with Vunakizumab Biosimilar led to a significant decrease in joint inflammation and bone destruction in a mouse model of RA.

Inflammatory Bowel Disease

Inflammatory bowel disease (IBD) is a group of chronic inflammatory conditions of the gastrointestinal tract, including Crohn’s disease and ulcerative colitis. IL-17A has been identified as a key cytokine in the pathogenesis of IBD, and Vunakizumab Biosimilar has shown promising results in preclinical studies as a potential treatment for this condition. In a mouse model of colitis, treatment with Vunakizumab Biosimilar led to a significant reduction in inflammation and improved disease severity.

Conclusion

Vunakizumab Biosimilar is a promising research grade antibody that specifically targets the pro-inflammatory cytokine IL-17A. Its potential as a therapeutic agent for various inflammatory and autoimmune diseases is currently being investigated in preclinical and clinical studies. If successful, this antibody could provide a new treatment option for patients suffering from these debilitating conditions.

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade (cat. No.PX-TA1444) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.347M.

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Vunakizumab Biosimilar – Anti-IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products