Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

IL17A, C-His, recombinant protein

  • PX-P5780
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q16552
Molecular weight:
18.47 kDa

$451.00

100ug + 451 loyalty points
Gly24–Ala155 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

IL17A, C-His, recombinant protein

Product name IL17A, C-His, recombinant protein
Uniprot ID Q16552
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight 18.47 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly24-Ala155
Protein Accession Q16552
Reference PX-P5780
Note For research use only.
Molecular Constructor
Gly24–Ala155 His

Secukinumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Secukinumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Secukinumab Biosimilar - Anti-IL17A mAb (cat. No.PX-TA1234) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Vunakizumab Biosimilar - Anti-IL17A mAb - Research Grade (cat. No.PX-TA1444) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 3.347M.

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Netakimab Biosimilar - Anti-IL17A mAb - Research Grade (cat. No.PX-TA1499) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 1.931M.

Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade (cat. No.PX-TA1494) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 129.6M.

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Bimekizumab Biosimilar - Anti-IL17A, IL17F mAb (cat. No.PX-TA1342) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Ixekizumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Ixekizumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Ixekizumab Biosimilar - Anti-IL17A mAb (cat. No.PX-TA1022) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

IL17A, C-His, recombinant protein

There are no reviews yet.

Be the first to review “IL17A, C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products