Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Afasevikumab Biosimilar – Anti-IL17A , IL17F mAb – Research Grade

  • PX-TA1401-50
  • Validated FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb - Research Grade

Product name Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb - Research Grade
Uniprot ID Q16552 & Q96PD4
Source CAS 1589503-30-9
Species Homo sapiens
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Afasevikumab,MCAF-5352A,NI-1401,RG-7624,RO5553110,IL17A , IL17F,anti-IL17A , IL17F
Reference PX-TA1401
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb - Research Grade
Uniprot ID Q16552 & Q96PD4
Source CAS 1589503-30-9
Species Homo sapiens
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Afasevikumab,MCAF-5352A,NI-1401,RG-7624,RO5553110,IL17A , IL17F,anti-IL17A , IL17F
Reference PX-TA1401
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1401-50
Uniprot ID Q16552 & Q96PD4
Source CAS 1589503-30-9
Species Homo sapiens
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Afasevikumab,MCAF-5352A,NI-1401,RG-7624,RO5553110,IL17A , IL17F,anti-IL17A , IL17F
Reference PX-TA1401
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-IL17A /IL17F[Homo sapiens] (Afasevikumab) Monoclonal Antibody

Afasevikumab is a monoclonal antibody that targets IL17 and is investigated for the treatment of Multiple Sclerosis(MS).

SDS-PAGE for Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb

SDS-PAGE for Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb

Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Afasevikumab Biosimilar - Anti-IL17A , IL17F mAb - Research Grade

There are no reviews yet.

Be the first to review “Afasevikumab Biosimilar – Anti-IL17A , IL17F mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products