Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Afasevikumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Afasevikumab ELISA Kit

Afasevikumab ELISA Kit

Product name Afasevikumab ELISA Kit
Uniprot ID Q16552 & Q96PD4
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX257
Note For research use only.
Sample type Plasma, Serum
Target Afasevikumab
Immunogen Afasevikumab

The Structure of Afasevikumab ELISA Kit

The Afasevikumab ELISA (Enzyme-Linked Immunosorbent Assay) Kit is a scientific tool used for the detection and quantification of Afasevikumab, a monoclonal antibody used as a therapeutic agent. The kit is composed of several components, including microtiter plates, reagents, and controls, all of which are specifically designed for the accurate measurement of Afasevikumab levels in various biological samples.

The microtiter plates in the Afasevikumab ELISA Kit are coated with a specific antigen, which is the target of the Afasevikumab antibody. This allows for the specific binding of Afasevikumab to the plate, ensuring high sensitivity and accuracy in the assay. The reagents included in the kit are designed to facilitate the binding of Afasevikumab to the antigen on the plate, as well as to detect and quantify the bound antibody. These reagents include a conjugate, a substrate, and a stop solution.

The Activity of Afasevikumab

Afasevikumab is a monoclonal antibody that specifically targets and binds to the human interleukin-17A (IL-17A) cytokine. IL-17A is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various autoimmune and inflammatory diseases, such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. By binding to IL-17A, Afasevikumab inhibits its activity and reduces the production of other pro-inflammatory cytokines, leading to a decrease in inflammation and disease symptoms.

The activity of Afasevikumab has been extensively studied in pre-clinical and clinical trials. In a phase II clinical trial, Afasevikumab showed significant efficacy in reducing the signs and symptoms of psoriasis, with a rapid onset of action and a sustained response. It has also shown promising results in the treatment of other inflammatory diseases, such as ankylosing spondylitis and psoriatic arthritis.

Application of Afasevikumab ELISA Kit

The Afasevikumab ELISA Kit has several applications in the field of biomedical research and drug development. One of its primary uses is in the measurement of Afasevikumab levels in biological samples, such as serum, plasma, and tissue homogenates. This allows for the monitoring of Afasevikumab levels in patients receiving treatment, as well as the evaluation of the pharmacokinetics and pharmacodynamics of the antibody.

Additionally, the Afasevikumab ELISA Kit can be used to screen potential therapeutic agents that target IL-17A. By measuring the binding affinity and potency of these agents, the kit can aid in the selection and optimization of potential drug candidates. It can also be used to assess the immunogenicity of Afasevikumab, as well as to detect any potential neutralizing antibodies that may affect its efficacy.

In conclusion, the Afasevikumab ELISA Kit is a valuable tool for the detection and quantification of Afasevikumab, a monoclonal antibody with potent anti-inflammatory activity. Its accurate and sensitive measurement of Afasevikumab levels makes it an essential tool in the development and monitoring of this therapeutic agent, as well as in the identification of potential new treatments for inflammatory diseases.

Afasevikumab ELISA Kit

There are no reviews yet.

Be the first to review “Afasevikumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products