Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Netakimab Biosimilar – Anti-IL17A mAb – Research Grade

  • PX-TA1499-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade

Product name Netakimab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1796570-08-5
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Netakimab,AG1-25,IL17A,anti-IL17A
Reference PX-TA1499
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Netakimab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source CAS 1796570-08-5
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Netakimab,AG1-25,IL17A,anti-IL17A
Reference PX-TA1499
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1499-50
Uniprot ID Q16552
Source CAS 1796570-08-5
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Netakimab,AG1-25,IL17A,anti-IL17A
Reference PX-TA1499
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Netakimab Biosimilar is a novel monoclonal antibody (mAb) that targets the cytokine Interleukin-17A (IL-17A), a key mediator of inflammation and autoimmune diseases. This biosimilar is a highly specific and potent therapeutic agent that has shown promising results in pre-clinical and clinical studies. In this article, we will discuss the structure, activity, and potential applications of Netakimab Biosimilar in the field of immunology and beyond.

Structure of Netakimab Biosimilar

Netakimab Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is produced in Chinese hamster ovary (CHO) cells. It has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains contain constant regions (Fc) and variable regions (Fab) while the light chains only have variable regions. The variable regions of Netakimab Biosimilar are responsible for its high specificity and binding affinity to IL-17A.

Activity of Netakimab Biosimilar

Netakimab Biosimilar works by binding to IL-17A and inhibiting its activity. IL-17A is a pro-inflammatory cytokine that is produced by a type of immune cells called Th17 cells. It plays a crucial role in the pathogenesis of various autoimmune diseases such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. By blocking the activity of IL-17A, Netakimab Biosimilar reduces inflammation and helps to control the symptoms of these diseases.

In addition to its anti-IL-17A activity, Netakimab Biosimilar also has an immunomodulatory effect. It has been shown to decrease the production of other pro-inflammatory cytokines, such as IL-6 and TNF-α, and increase the production of anti-inflammatory cytokines, such as IL-10. This dual mechanism of action makes Netakimab Biosimilar a promising therapeutic option for a wide range of inflammatory and autoimmune conditions.

Potential Applications of Netakimab Biosimilar

Netakimab Biosimilar has been studied in various pre-clinical and clinical trials for the treatment of different autoimmune diseases. In a phase III clinical trial, it showed significant efficacy in treating moderate to severe plaque psoriasis, with a high percentage of patients achieving clear or almost clear skin after 12 weeks of treatment. Other clinical trials have also demonstrated its effectiveness in treating psoriatic arthritis, ankylosing spondylitis, and rheumatoid arthritis.

Moreover, Netakimab Biosimilar has also shown potential in the treatment of non-autoimmune conditions. IL-17A has been implicated in the development of certain cancers, such as breast and lung cancer, and Netakimab Biosimilar has been shown to inhibit tumor growth in pre-clinical studies. It has also been studied for its potential in treating chronic obstructive pulmonary disease (COPD) and asthma, both of which have an inflammatory component.

Conclusion

In summary, Netakimab Biosimilar is a promising therapeutic agent with a unique mechanism of action. Its high specificity and dual activity make it a potential treatment option for various autoimmune diseases and other inflammatory conditions. With ongoing research and clinical trials, Netakimab Biosimilar has the potential to improve the lives of patients suffering from these debilitating diseases.

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Netakimab Biosimilar - Anti-IL17A mAb - Research Grade (cat. No.PX-TA1499) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 1.931M.

Netakimab Biosimilar - Anti-IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Netakimab Biosimilar – Anti-IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products