Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ixekizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Ixekizumab ELISA Kit

Ixekizumab ELISA Kit

Product name Ixekizumab ELISA Kit
Uniprot ID Q16552
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX259
Note For research use only.
Sample type Plasma, Serum
Target Ixekizumab
Immunogen Ixekizumab

The Structure of Ixekizumab ELISA Kit

Ixekizumab ELISA Kit is a highly specific and sensitive enzyme-linked immunosorbent assay (ELISA) designed for the quantitative measurement of Ixekizumab in various biological samples. Ixekizumab is a humanized monoclonal antibody that targets interleukin-17A (IL-17A), a pro-inflammatory cytokine involved in the pathogenesis of various autoimmune and inflammatory diseases.

The kit is composed of several components, including a microplate coated with a capture antibody specific for Ixekizumab, a detection antibody conjugated to an enzyme, and a substrate solution that produces a colorimetric signal in the presence of the enzyme. The assay is performed in a 96-well format, allowing for the simultaneous analysis of multiple samples.

The capture antibody used in the kit is a mouse monoclonal antibody that recognizes a specific epitope on Ixekizumab. This antibody is immobilized on the surface of the microplate, providing a solid support for the detection of Ixekizumab. The detection antibody is a biotinylated polyclonal antibody specific for a different epitope on Ixekizumab. This antibody is conjugated to an enzyme, such as horseradish peroxidase (HRP) or alkaline phosphatase (AP), which catalyzes a colorimetric reaction in the presence of a substrate.

The Activity of Ixekizumab ELISA Kit

The Ixekizumab ELISA Kit is a highly sensitive and specific assay that allows for the quantitative measurement of Ixekizumab in various biological samples, including serum, plasma, and cell culture supernatants. The assay has a detection range of 0.1-10 ng/mL and a lower limit of quantification (LLOQ) of 0.1 ng/mL, making it suitable for the detection of low levels of Ixekizumab.

The activity of the Ixekizumab ELISA Kit is based on the principle of competitive binding. During the assay, the sample containing Ixekizumab is added to the microplate coated with the capture antibody. The Ixekizumab in the sample competes with a fixed amount of Ixekizumab-HRP conjugate for binding to the capture antibody. After a washing step to remove any unbound components, a substrate solution is added to the wells. The intensity of the color produced is inversely proportional to the concentration of Ixekizumab in the sample, allowing for the quantification of Ixekizumab.

The Application of Ixekizumab ELISA Kit

Ixekizumab ELISA Kit has a wide range of applications in both research and clinical settings. It is primarily used for the measurement of Ixekizumab levels in biological samples to monitor drug levels in patients undergoing treatment with Ixekizumab. This can help clinicians determine the optimal dose and frequency of administration for individual patients.

In addition, the kit can also be used in preclinical studies to assess the pharmacokinetics and pharmacodynamics of Ixekizumab. It can also be used to measure the levels of Ixekizumab in animal models, providing valuable information for drug development and efficacy studies.

Furthermore, the Ixekizumab ELISA Kit can be used in basic research to study the role of IL-17A in various disease states. It can also be used to compare the levels of Ixekizumab in different patient populations, such as those with psoriasis, psoriatic arthritis, or ankylosing spondylitis, to better understand the efficacy of Ixekizumab in these conditions.

In summary, the Ixekizumab ELISA Kit is a powerful tool for the accurate and quantitative measurement of Ixekizumab in various biological samples. Its high sensitivity, specificity, and wide range of

Ixekizumab ELISA Kit

There are no reviews yet.

Be the first to review “Ixekizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products