Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ixekizumab Biosimilar – Anti-IL17A mAb – Research Grade

  • PX-TA1022-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade

Product name Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source DrugBank DB11569
Species Human
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight 146kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ixekizumab,Ixekizumab,IL17A,anti-IL17A
Reference PX-TA1022
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4Kappa
Clonality Monoclonal Antibody
Product name Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade
Uniprot ID Q16552
Source DrugBank DB11569
Species Human
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight 146kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ixekizumab,Ixekizumab,IL17A,anti-IL17A
Reference PX-TA1022
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4Kappa
Clonality Monoclonal Antibody
Product name PX-TA1022-50
Uniprot ID Q16552
Source DrugBank DB11569
Species Human
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Molecular weight 146kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ixekizumab,Ixekizumab,IL17A,anti-IL17A
Reference PX-TA1022
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

General information about Ixekizumab

Recombinant monoclonal antibody to IL17A. Ixekizumab is a humanized monoclonal antibody used in the treatment of autoimmune diseases. This product is for research use only.

SDS-PAGE for Ixekizumab Biosimilar - Anti-IL17A mAb

SDS-PAGE for Ixekizumab Biosimilar - Anti-IL17A mAb

Ixekizumab Biosimilar - Anti-IL17A mAb on SDS-PAGE under reducing (left figure) and non-reducing (right figure) conditions. The gel was stained overnight with Coomassie Blue. The purity of the antibody is superior than 90 %.

Ixekizumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Ixekizumab Biosimilar - Anti-IL17A mAb binds to IL17A, C-His, recombinant protein in indirect ELISA Assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind to Ixekizumab Biosimilar - Anti-IL17A mAb (cat. No.PX-TA1022) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Ixekizumab Biosimilar - Anti-IL17A mAb - Research Grade

There are no reviews yet.

Be the first to review “Ixekizumab Biosimilar – Anti-IL17A mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products