Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Siltuximab Biosimilar – Anti-IL6 mAb – Research Grade

  • PX-TA1029-50
  • Validated ELISA WB
Isotype:
IgG1, kappa

Original price was: $203.00.Current price is: $167.00.

50ug 18% OFF + 167 loyalty points

Siltuximab Anti-IL6 Monoclonal Antibody for Cytokine Research

Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade

Product name Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source DrugBank DB09036
Species Human
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 145kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Siltuximab,Siltuximab,IL6,anti-IL6
Reference PX-TA1029
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody
Product name Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source DrugBank DB09036
Species Human
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 145kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Siltuximab,Siltuximab,IL6,anti-IL6
Reference PX-TA1029
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1Kappa
Clonality Monoclonal Antibody
Product name PX-TA1029-50
Uniprot ID P05231
Source DrugBank DB09036
Species Human
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 145kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Siltuximab,Siltuximab,IL6,anti-IL6
Reference PX-TA1029
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa

General Information on Siltuximab Anti-IL6 Monoclonal Antibody

The Siltuximab antibody is a chimeric mouse/human monoclonal antibody designed to bind human interleukin-6 (IL-6), a soluble glycoprotein involved in pro-inflammatory signaling pathways.

Siltuximab is widely studied in research involving cytokine signaling, immune response regulation and inflammatory mechanisms. IL-6 is one of the major pro-inflammatory cytokines overexpressed in multiple pathological conditions and is produced by several cell types including T cells, B cells, monocytes, fibroblasts and endothelial cells.

By interacting with membrane-bound or soluble IL-6 receptors (IL6R), IL-6 can trigger multiple biological responses such as B-cell proliferation, vascular endothelial growth factor (VEGF) production and immune system dysregulation.

Siltuximab has been investigated in research related to inflammatory diseases, oncology and cytokine-mediated pathways, including studies involving multicentric Castleman disease (MCD), multiple myeloma and immune response dysregulation

Applications

This anti-IL6 monoclonal antibody is suitable for:

  • cytokine signaling studies
  • ELISA and binding assays
  • antibody characterization
  • immunology research
  • inflammation-related studies
  • cell-based assays

This Siltuximab biosimilar anti-IL6 monoclonal antibody is intended for research use only.

SDS-PAGE for Siltuximab Biosimilar - Anti-IL6 mAb

SDS-PAGE for Siltuximab Biosimilar - Anti-IL6 mAb

Siltuximab Biosimilar - Anti-IL6 mAb, on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Siltuximab Biosimilar- Anti-IL6 mAb binds to Human IL6 in indirect ELISA assay

Siltuximab Biosimilar- Anti-IL6 mAb binds to Human IL6 in indirect ELISA assay

Immobilized Human IL6 Recombinant Protein (cat. No.PX-P3013) at 0.5µg/mL (100µL/well) can bind Siltuximab Biosimilar- Anti-IL6 mAb (cat. No.PX-TA1029) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 62.18M.

Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade binds to IL6, C-His, recombinant protein in WB Assay

Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade binds to IL6, C-His, recombinant protein in WB Assay

IL6, C-His, recombinant protein(cat. No.PX-P5793) can bind Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade in Western Blot Assay as detected on gel analysis.

SEC-HPLC of Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade

SEC-HPLC of Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade

Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade was analyzed by size exclusion chromatography with UV detection.

Siltuximab Biosimilar - Anti-IL6 mAb - Research Grade

There are no reviews yet.

Be the first to review “Siltuximab Biosimilar – Anti-IL6 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products