Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human IL6 recombinant protein (Met 1~Met212)

  • PX-P5129-50
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P05231
Molecular weight:
24.69 kDa

Original price was: $455.00.Current price is: $350.00.

50ug 23% OFF + 350 loyalty points
Met1–Met212 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human IL6 recombinant protein (Met 1~Met212)

Product name PX-P5129-100
Uniprot ID P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 24.69 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met 1-Met212
Protein Accession P05231
Aliases /Synonyms IFNB2,BSF-2,CDF,Hybridoma Growth Factor proteins,IFN-beta-2
Reference PX-P5129
Note For research use only
Molecular Constructor
Met1–Met212 His
Product name PX-P5129-1MG
Uniprot ID P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 24.69 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met 1-Met212
Protein Accession P05231
Aliases /Synonyms IFNB2,BSF-2,CDF,Hybridoma Growth Factor proteins,IFN-beta-2
Reference PX-P5129
Note For research use only
Molecular Constructor
Met1–Met212 His
Product name PX-P5129-50
Uniprot ID P05231
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular weight 24.69 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met 1-Met212
Protein Accession P05231
Aliases /Synonyms IFNB2,BSF-2,CDF,Hybridoma Growth Factor proteins,IFN-beta-2
Reference PX-P5129
Note For research use only
Molecular Constructor
Met1–Met212 His

Clazakizumab Biosimilar - Anti-IL6 mAb binds to Human IL6 recombinant protein (Met 1~Met212) in indirect ELISA Assay

Clazakizumab Biosimilar - Anti-IL6 mAb binds to Human IL6 recombinant protein (Met 1~Met212) in indirect ELISA Assay

Immobilized Human IL6 recombinant protein (Met 1~Met212) (cat. No.PX-P5129) at 0.5µg/mL (100µL/well) can bind to Clazakizumab Biosimilar - Anti-IL6 mAb (cat. No.PX-TA1288) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human IL6 recombinant protein (Met 1~Met212)

There are no reviews yet.

Be the first to review “Human IL6 recombinant protein (Met 1~Met212)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products