Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Elsilimomab Biosimilar – Anti-IL6 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: $201.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade

Product name Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source CAS 468715-71-1
Species Mus musculus
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Elsilimomab,B-E8,IL6,anti-IL6
Reference PX-TA1192
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade
Uniprot ID P05231
Source CAS 468715-71-1
Species Mus musculus
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Elsilimomab,B-E8,IL6,anti-IL6
Reference PX-TA1192
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1192-50
Uniprot ID P05231
Source CAS 468715-71-1
Species Mus musculus
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Elsilimomab,B-E8,IL6,anti-IL6
Reference PX-TA1192
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction to Elsilimomab Biosimilar – Anti-IL6 mAb Keywords: Elsilimomab, Biosimilar, Anti-IL6 mAb, therapeutic target, antibody

Elsilimomab Biosimilar is a novel monoclonal antibody (mAb) that targets the cytokine IL-6, a key mediator of inflammation and immune response. This biosimilar is a research grade version of the original Elsilimomab, which was developed as a therapeutic agent for the treatment of various inflammatory diseases. In this article, we will explore the structure, activity, and potential applications of Elsilimomab Biosimilar as an anti-IL6 mAb.

Structure of Elsilimomab Biosimilar

Elsilimomab Biosimilar is a humanized IgG1 monoclonal antibody, which means it is composed of both human and mouse components. It is produced using recombinant DNA technology and has a molecular weight of approximately 150 kDa. The antibody consists of two heavy chains and two light chains, each containing variable and constant regions. The variable regions are responsible for binding to the target IL-6, while the constant regions play a role in immune effector functions.

Activity of Elsilimomab Biosimilar

Elsilimomab Biosimilar specifically targets IL-6, a pro-inflammatory cytokine that plays a crucial role in the regulation of immune response and inflammation. IL-6 is produced by a variety of cells, including T cells, B cells, macrophages, and fibroblasts, and has been implicated in the pathogenesis of various diseases such as rheumatoid arthritis, Crohn’s disease, and multiple myeloma. By binding to IL-6, Elsilimomab Biosimilar blocks its interaction with its receptor, thereby inhibiting downstream signaling pathways and reducing inflammation.

Potential Applications of Elsilimomab Biosimilar

As an anti-IL6 mAb, Elsilimomab Biosimilar has the potential to be used in the treatment of various inflammatory diseases. Its ability to block IL-6 signaling makes it a promising candidate for the treatment of rheumatoid arthritis, a chronic inflammatory disorder characterized by joint inflammation and destruction. In a phase II clinical trial, Elsilimomab Biosimilar showed promising results in reducing disease activity and improving symptoms in patients with rheumatoid arthritis.

In addition to rheumatoid arthritis, Elsilimomab Biosimilar may also have potential applications in other inflammatory diseases such as Crohn’s disease and multiple myeloma. Crohn’s disease is a chronic inflammatory disorder of the gastrointestinal tract, and IL-6 has been implicated in its pathogenesis. By targeting IL-6, Elsilimomab Biosimilar may help alleviate symptoms and improve disease outcomes in patients with Crohn’s disease. Similarly, IL-6 has been shown to play a role in the growth and survival of multiple myeloma cells, and Elsilimomab Biosimilar may have a therapeutic effect in this disease as well.

Conclusion

Elsilimomab Biosimilar is a research grade anti-IL6 mAb that has the potential to be used in the treatment of various inflammatory diseases. Its unique structure and activity make it a promising candidate for targeting IL-6, a key mediator of inflammation and immune response. With further research and clinical trials, Elsilimomab Biosimilar may become a valuable therapeutic option for patients with inflammatory diseases.

SDS-PAGE for Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade

SDS-PAGE for Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade

Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade , on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Elsilimomab Biosimilar - Anti-IL6 mAb - Research Grade

There are no reviews yet.

Be the first to review “Elsilimomab Biosimilar – Anti-IL6 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products