Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Interleukin-6(IL6)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
F1PXV9
Molecular weight:
21.99kDa

$250.00

50ug + 250 loyalty points
Met1–Met207 His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Interleukin-6(IL6)

Interleukin-6(IL6)

Product name Interleukin-6(IL6)
Uniprot ID F1PXV9
Uniprot link https://www.uniprot.org/uniprot/F1PXV9
Expression system Prokaryotic expression
Sequence MFPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDECVKHTTIHLILRSLEDFLQFSLRAVRIMGSHHHHHH
Molecular weight 21.99kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Met207
Protein Accession NP_001003301
NCBI Reference NP_001003301
Aliases /Synonyms /
Reference PX-P4874
Note For research use only
Molecular Constructor
Met1–Met207 His
Product name Interleukin-6(IL6)
Uniprot ID F1PXV9
Uniprot link https://www.uniprot.org/uniprot/F1PXV9
Expression system Prokaryotic expression
Sequence MFPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDECVKHTTIHLILRSLEDFLQFSLRAVRIMGSHHHHHH
Molecular weight 21.99kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Met207
Protein Accession NP_001003301
NCBI Reference NP_001003301
Aliases /Synonyms /
Reference PX-P4874
Note For research use only
Molecular Constructor
Met1–Met207 His

There are no reviews yet.

Be the first to review “Interleukin-6(IL6)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products