Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Levilimab Biosimilar – Anti-IL6R mAb – Research Grade

  • PX-TA1545-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Levilimab Biosimilar - Anti-IL6R mAb - Research Grade

Product name Levilimab Biosimilar - Anti-IL6R mAb - Research Grade
Uniprot ID P08887
Source CAS 2035008-70-7
Species Homo sapiens
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Levilimab ,BCD-089,IL6R,anti-IL6R
Reference PX-TA1545
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Levilimab Biosimilar - Anti-IL6R mAb - Research Grade
Uniprot ID P08887
Source CAS 2035008-70-7
Species Homo sapiens
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Levilimab ,BCD-089,IL6R,anti-IL6R
Reference PX-TA1545
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1545-50
Uniprot ID P08887
Source CAS 2035008-70-7
Species Homo sapiens
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Levilimab ,BCD-089,IL6R,anti-IL6R
Reference PX-TA1545
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Levilimab Biosimilar, also known as Anti-IL6R mAb, is a research grade monoclonal antibody that has been developed as a biosimilar to the original Levilimab therapeutic antibody. Levilimab Biosimilar targets the interleukin-6 receptor (IL6R), a key protein involved in inflammatory and immune responses. In this article, we will explore the structure, activity, and potential applications of Levilimab Biosimilar.

Structure of Levilimab Biosimilar

Levilimab Biosimilar is a monoclonal antibody, meaning it is produced by a single clone of immune cells. It is a protein composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy and light chains together form the antigen-binding fragment (Fab) of the antibody, which is responsible for binding to its target.

The constant region of the antibody, known as the Fc region, is responsible for the effector functions of the antibody, such as activating immune cells and promoting the clearance of pathogens. Levilimab Biosimilar has been engineered to have the same Fc region as the original Levilimab antibody, ensuring similar effector functions.

Activity of Levilimab Biosimilar

Levilimab Biosimilar binds specifically to the IL6R on the surface of cells. IL6R is a receptor for interleukin-6 (IL-6), a cytokine that plays a crucial role in inflammation and immune responses. By binding to IL6R, Levilimab Biosimilar blocks the interaction between IL-6 and its receptor, inhibiting downstream signaling pathways.

This blockade of IL-6 signaling has several effects, including reducing the production of pro-inflammatory cytokines, promoting anti-inflammatory cytokines, and modulating immune cell function. These activities make Levilimab Biosimilar a potential therapeutic option for various inflammatory and autoimmune diseases.

Potential Applications of Levilimab Biosimilar

As a biosimilar to Levilimab, this antibody has the potential to treat the same diseases as the original therapeutic antibody. Levilimab Biosimilar is currently being investigated in clinical trials for the treatment of rheumatoid arthritis, psoriasis, and other autoimmune diseases.

In addition, Levilimab Biosimilar has shown promise in the treatment of cytokine release syndrome (CRS), a severe immune reaction that can occur in response to certain therapies, such as CAR T-cell therapy. By blocking IL-6 signaling, Levilimab Biosimilar can potentially reduce the severity of CRS and improve patient outcomes.

Conclusion

In summary, Levilimab Biosimilar is a research grade monoclonal antibody that targets the IL6R and has similar structure and activity as the original Levilimab therapeutic antibody. It has the potential to treat various inflammatory and autoimmune diseases, as well as reduce the severity of cytokine release syndrome. Further research and clinical trials are needed to fully understand the potential of Levilimab Biosimilar in treating these conditions.

Levilimab Biosimilar - Anti-CD126;IL6R mAb - Research Grade binds to CD126 Recombinant Protein in ELISA assay

Levilimab Biosimilar - Anti-CD126;IL6R mAb - Research Grade binds to CD126 Recombinant Protein in ELISA assay

Immobilized CD126 Recombinant Protein (cat. No.PX-P4104) at 0.5µg/mL (100µL/well) can bind Levilimab Biosimilar - Anti-CD126;IL6R mAb - Research Grade (cat. No.PX-TA1545) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 1.08M.

Levilimab  Biosimilar - Anti-IL6R mAb - Research Grade

There are no reviews yet.

Be the first to review “Levilimab Biosimilar – Anti-IL6R mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products