Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Satralizumab ELISA Kit

Assay type:
Quantitative, Competitive

$893.00

96T + 893 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Satralizumab ELISA Kit

Satralizumab ELISA Kit

Product name Satralizumab ELISA Kit
Uniprot ID P08887
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stocks, 3-5 weeks if production is needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Sapelizumab, SA-237, SA237, satralizumab-mwg, CAS: 1535963-91-7
Note For research use only.
Target Satralizumab
Immunogen Satralizumab
Assay type Quantitative, Competitive

Introduction

Satralizumab is a humanized monoclonal antibody that targets the interleukin-6 (IL-6) receptor, a key mediator of inflammation in various autoimmune diseases. It is currently being developed as a potential therapeutic target for the treatment of neuromyelitis optica spectrum disorder (NMOSD), a rare autoimmune disease that affects the central nervous system.

Structure of Satralizumab

Satralizumab is a recombinant humanized IgG1 monoclonal antibody with a molecular weight of approximately 148 kDa. It is composed of two heavy chains and two light chains, and is produced by recombinant DNA technology in Chinese hamster ovary cells. The antibody has a high affinity for the IL-6 receptor and is designed to specifically bind to its target.

Mechanism of Action

Satralizumab works by binding to the IL-6 receptor and blocking its interaction with IL-6, thereby inhibiting the downstream signaling pathways that lead to inflammation. This mechanism of action is similar to that of other IL-6 inhibitors, such as tocilizumab and sarilumab. However, Satralizumab has been engineered to have a longer half-life and higher binding affinity, making it a potentially more effective treatment option.

Application of Satralizumab

The primary application of Satralizumab is in the treatment of NMOSD, a rare autoimmune disorder that primarily affects the optic nerves and spinal cord. It is characterized by recurrent attacks of inflammation, leading to damage and disability in these areas. Currently, there are limited treatment options available for NMOSD, and Satralizumab has shown promising results in clinical trials as a potential therapy.

Research Use of Satralizumab ELISA Kit

The development of a Satralizumab ELISA (enzyme-linked immunosorbent assay) kit has allowed for the measurement of Satralizumab levels in patient samples. This has been particularly useful in clinical trials, where the kit has been used to assess the pharmacokinetics and pharmacodynamics of the drug in patients with NMOSD. The kit can also be used for research purposes to study the distribution and elimination of Satralizumab in different tissues and organs.

Therapeutic Target for NMOSD

Satralizumab is being investigated as a potential therapeutic target for NMOSD due to its ability to specifically target the IL-6 receptor, which plays a key role in the pathogenesis of the disease. In clinical trials, Satralizumab has shown significant reductions in the frequency of relapses and improvements in disability scores in patients with NMOSD. If approved, it could provide a much-needed treatment option for this rare and debilitating disease.

Conclusion

Satralizumab is a promising new therapy for NMOSD, with a unique mechanism of action and potential advantages over other IL-6 inhibitors. Its development has been aided by the use of a Satralizumab ELISA kit, which allows for the measurement of drug levels in patient samples. As research and clinical trials continue, Satralizumab has the potential to become a valuable therapeutic option for patients with NMOSD.

There are no reviews yet.

Be the first to review “Satralizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products