Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Satralizumab Biosimilar – Anti-IL6R mAb – Research Grade

  • PX-TA1407-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $326.00.Current price is: $238.00.

100ug 27% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Satralizumab Biosimilar - Anti-IL6R mAb - Research Grade

Product name Satralizumab Biosimilar - Anti-IL6R mAb - Research Grade
Uniprot ID P08887
Source CAS 1535963-91-7
Species Humanized
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Satralizumab,SA-237,IL6R,anti-IL6R
Reference PX-TA1407
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Satralizumab Biosimilar - Anti-IL6R mAb - Research Grade
Uniprot ID P08887
Source CAS 1535963-91-7
Species Humanized
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Satralizumab,SA-237,IL6R,anti-IL6R
Reference PX-TA1407
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1407-50
Uniprot ID P08887
Source CAS 1535963-91-7
Species Humanized
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Satralizumab,SA-237,IL6R,anti-IL6R
Reference PX-TA1407
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

General information on Anti-IL6R[Homo sapiens] (Satralizumab) Monoclonal Antibody

Satralizumab is a humanized monoclonal antibody that targets human interleukin-6 (IL-6) receptors, similar to tocilizumab. Satralizumab is used to treat neuromyelitis optica spectrum disorder (NMOSD). Increased production of anti-aquaporin-4 (AQP4) autoantibodies and increased permeability of the blood-brain barrier are thought to be mediated by IL-6. Satralizumab is thought to block IL-6 receptors and, thereby, these inflammatory responses.

Satralizumab Biosimilar - Anti-IL6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Satralizumab Biosimilar - Anti-IL6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Immobilized CD126 Recombinant Protein (cat. No.PX-P4104) at 0.5µg/mL (100µL/well) can bind to Satralizumab Biosimilar - Anti-IL6R mAb (cat. No.PX-TA1407) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

SDS-PAGE for Satralizumab Biosimilar - Anti-IL6R mAb - Research Grade

SDS-PAGE for Satralizumab Biosimilar - Anti-IL6R mAb - Research Grade

Satralizumab Biosimilar - Anti-IL6R mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Satralizumab Biosimilar - Anti-IL6R mAb - Research Grade

There are no reviews yet.

Be the first to review “Satralizumab Biosimilar – Anti-IL6R mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products