Brand: ProteoGenix

Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein

PX-P4046-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P08887
Molecular weight:: 41.12kDa

$250.00

50ug + 250 loyalty points

Partial Yes

size size

50ug $250.00
100ug $500.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein

Product name	Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein
Uniprot ID	P08887
Uniprot link	http://www.uniprot.org/uniprot/P08887
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPGSHHHHHH
Molecular weight	41.12kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	CD126, gp80, IL6R, IL-6R-1, IL-6R-Alpha, IL6RA, IL-6 receptor subunit alpha, Membrane glycoprotein 80
Reference	PX-P4046
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein
Uniprot ID	P08887
Uniprot link	http://www.uniprot.org/uniprot/P08887
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPGSHHHHHH
Molecular weight	41.12kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	CD126, gp80, IL6R, IL-6R-1, IL-6R-Alpha, IL6RA, IL-6 receptor subunit alpha, Membrane glycoprotein 80
Reference	PX-P4046
Note	For research use only
Molecular Constructor	Partial Yes

General Information aboutHuman CD126/IL6R/Interleukin-6 receptor subunit alpha recombinant protein

A portion of the interleukin 6 receptor, which binds to IL6 with low affinity, but does not transmit signals (PubMed: 28265003). Signal activation must be related to IL6ST. Activation leads to immune response, acute phase response, and regulation of hematopoietic function (possibly). The interaction of membrane-bound IL6R and IL6ST stimulates “classical signaling” and the limited expression of IL6R limits classical IL6 signaling to only a few tissues, such as the liver and some cells of the immune system. In the process of binding of IL6R and soluble IL6R to IL6ST, “anti-signal transmission” is stimulated. Furthermore, when the membrane-bound IL6: IL6R complex on the transmitting cell activates the IL6ST receptor on the adjacent receptor, the “raster signal” will (possibly) occur

There are no reviews yet.

Be the first to review “Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein”

Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein

Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein

General Information aboutHuman CD126/IL6R/Interleukin-6 receptor subunit alpha recombinant protein

Related products

Adalimumab Biosimilar – Anti-TNF alpha mAb – Research Grade

Infliximab Biosimilar – Anti-TNF-alpha mAb – Research Grade

Certolizumab Biosimilar – Anti-TNF-Alpha mAb – Research Grade

Olaratumab Biosimilar – Anti-PDGF-R alpha mAb – Research Grade

Afelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Golimumab Biosimilar – Anti-TNFA, TNF alpha mAb – Research Grade

CDP571 Biosimilar – Anti-TNFSF2, TNF alpha, TNFA mAb – Research Grade

Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Rontalizumab Biosimilar – Anti-IFNA1 mAb – Research Grade

Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Placulumab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Tosatoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade

Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Suvratoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade

Alpha-lactalbumin(LALBA)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein

Specifications Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein

Description

General Information aboutHuman CD126/IL6R/Interleukin-6 receptor subunit alpha recombinant protein

Documents

Reviews

Related products

Adalimumab Biosimilar – Anti-TNF alpha mAb – Research Grade

Infliximab Biosimilar – Anti-TNF-alpha mAb – Research Grade

Certolizumab Biosimilar – Anti-TNF-Alpha mAb – Research Grade

Olaratumab Biosimilar – Anti-PDGF-R alpha mAb – Research Grade

Afelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Golimumab Biosimilar – Anti-TNFA, TNF alpha mAb – Research Grade

CDP571 Biosimilar – Anti-TNFSF2, TNF alpha, TNFA mAb – Research Grade

Nerelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Rontalizumab Biosimilar – Anti-IFNA1 mAb – Research Grade

Ozoralizumab Biosimilar – Anti-ALB, TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Placulumab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Tosatoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade

Remtolumab Biosimilar – Anti-IL17A, TNFSF2, TNF-alpha, TNFA mAb – Research Grade

Suvratoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade

Alpha-lactalbumin(LALBA)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein