Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Alpha-lactalbumin(LALBA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P00709
Molecular weight:
15.1kDa

Original price was: $313.00.Current price is: $250.00.

50ug 20% OFF + 250 loyalty points
Lys20–Leu142 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Alpha-lactalbumin(LALBA)

Product name Alpha-lactalbumin(LALBA)
Uniprot ID P00709
Uniprot link https://www.uniprot.org/uniprot/P00709
Expression system Prokaryotic expression
Raw Antigen Sequence MKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLEHHHHHH
Molecular weight 15.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys20-Leu142
Protein Accession P00709
Spec:Entrez GeneID 3906
Spec:NCBI Gene Aliases LYZG
Spec:SwissProtID Q6FGX0
NCBI Reference P00709
Aliases /Synonyms LYZL7,Lactose synthase B protein,Lysozyme-like protein 7
Reference PX-P4700
Note For research use only
Molecular Constructor
Lys20–Leu142 His
Product name Alpha-lactalbumin(LALBA)
Uniprot ID P00709
Uniprot link https://www.uniprot.org/uniprot/P00709
Expression system Prokaryotic expression
Raw Antigen Sequence MKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLEHHHHHH
Molecular weight 15.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys20-Leu142
Protein Accession P00709
Spec:Entrez GeneID 3906
Spec:NCBI Gene Aliases LYZG
Spec:SwissProtID Q6FGX0
NCBI Reference P00709
Aliases /Synonyms LYZL7,Lactose synthase B protein,Lysozyme-like protein 7
Reference PX-P4700
Note For research use only
Molecular Constructor
Lys20–Leu142 His
Product name PX-P4700-1MG
Uniprot ID P00709
Uniprot link https://www.uniprot.org/uniprot/P00709
Expression system Prokaryotic expression
Raw Antigen Sequence MKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLEHHHHHH
Molecular weight 15.1kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys20-Leu142
Protein Accession P00709
Spec:Entrez GeneID 3906
Spec:NCBI Gene Aliases LYZG
Spec:SwissProtID Q6FGX0
NCBI Reference P00709
Aliases /Synonyms LYZL7,Lactose synthase B protein,Lysozyme-like protein 7
Reference PX-P4700
Note For research use only
Molecular Constructor
Lys20–Leu142 His

Alpha-lactalbumin(LALBA)

There are no reviews yet.

Be the first to review “Alpha-lactalbumin(LALBA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products