Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Infliximab Biosimilar – Anti-TNF-alpha mAb – Research Grade

  • PX-TA1009-50
  • Validated ELISA FC
Isotype:
IgG1

Original price was: $123.00.Current price is: $100.00.

50ug 19% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Infliximab Biosimilar - Anti-TNF-alpha mAb - Research Grade

Product name Infliximab Biosimilar - Anti-TNF-alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00065
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Infliximab,Infliximab,TNF-alpha,anti-TNF-alpha
Reference PX-TA1009
Note For research use only. Not suitable for human use.
Isotype IgG1
Product name Infliximab Biosimilar - Anti-TNF-alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00065
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Infliximab,Infliximab,TNF-alpha,anti-TNF-alpha
Reference PX-TA1009
Note For research use only. Not suitable for human use.
Isotype IgG1
Product name PX-TA1009-50
Uniprot ID P01375
Source DrugBank DB00065
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Infliximab,Infliximab,TNF-alpha,anti-TNF-alpha
Reference PX-TA1009
Note For research use only. Not suitable for human use.
Isotype IgG1
Product name Infliximab Biosimilar - Anti-TNF-alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00065
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Infliximab,Infliximab,TNF-alpha,anti-TNF-alpha
Reference PX-TA1009
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name Infliximab Biosimilar - Anti-TNF-alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB00065
Species Human
Expression system Mammalian
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 144kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Infliximab,Infliximab,TNF-alpha,anti-TNF-alpha
Reference PX-TA1009
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

General information about Infliximab

Infliximab, a chimeric monoclonal antibody, is a medication used to treat a number of autoimmune diseases. This includes Crohn’s disease, ulcerative colitis, rheumatoid arthritis, ankylosing spondylitis, psoriasis, psoriatic arthritis, and Behçet’s disease. It is given by slow injection into a vein, typically at six- to eight-week intervals. Infliximab was originally developed in mice as a mouse antibody. Because humans have immune reactions to mouse proteins, the mouse common domains were replaced with similar human antibody domains. They are monoclonal antibodies and have identical structures and affinities to the target. Because they are a combination of mouse and human antibody amino acid sequences, they are called a “chimeric monoclonal antibody”. This product is for research use only.

Infliximab Biosimilar - Anti-TNF-alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Infliximab Biosimilar - Anti-TNF-alpha mAb binds to Human TNFa/TNF-alpha in indirect ELISA Assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Infliximab Biosimilar - Anti-TNF-alpha mAb (cat. No.PX-TA1009) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 60.68M.

SDS-PAGE for Infliximab Biosimilar - Anti-TNF-alpha mAb

SDS-PAGE for Infliximab Biosimilar - Anti-TNF-alpha mAb

Infliximab Biosimilar - Anti-TNF-alpha mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SPR results for Infliximab Biosimilar - Anti-TNF-alpha mAb and Human TNFa/TNF-alpha

SPR results for Infliximab Biosimilar - Anti-TNF-alpha mAb and Human TNFa/TNF-alpha

Human TNFa Recombinant Protein (cat. No. PX-P3058) and Infliximab Biosimilar - Anti-TNF-alpha mAb (cat. No. PX-TA1009) were injected in OpenSPR giving a KD of 3.26E-09.

Flow Cytometry results for Infliximab Biosimilar - Anti-TNF-alpha mAb - Research Grade

Flow Cytometry results for Infliximab Biosimilar - Anti-TNF-alpha mAb - Research Grade

Flow-cytometry PE using anti-human TNFa antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an PE anti-human TNFa monoclonal antibody (Catalog: PX-TA1009) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Infliximab Biosimilar - Anti-TNF-alpha mAb - Research Grade

Flow Cytometry results for Infliximab Biosimilar - Anti-TNF-alpha mAb - Research Grade

Flow-cytometry using anti-human TNFa antibody. 293T Transtected cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human TNFa monoclonal antibody (Catalog: PX-TA1009, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a a Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Infliximab Biosimilar - Anti-TNF-alpha mAb - Research Grade

There are no reviews yet.

Be the first to review “Infliximab Biosimilar – Anti-TNF-alpha mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products